DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14777 and mpv17l

DIOPT Version :9

Sequence 1:NP_001162634.1 Gene:CG14777 / 31099 FlyBaseID:FBgn0026872 Length:196 Species:Drosophila melanogaster
Sequence 2:XP_002938322.1 Gene:mpv17l / 100493944 XenbaseID:XB-GENE-5755324 Length:203 Species:Xenopus tropicalis


Alignment Length:174 Identity:49/174 - (28%)
Similarity:84/174 - (48%) Gaps:2/174 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SKLHPMAKGALTYAVMWPAGSLIQQAMEGRKLREYDWARALRFSLFGALYVAPTLYGWVRLTSAM 84
            :|.||.......|..::.:..::||.:........|:.:..:..:.|..:.|...:.|:|.....
 Frog     8 TKRHPWLTNVTIYGSLFASADIVQQKLSKSPGEPIDFKQTAKVGIVGFCFHANFNFFWLRFIERT 72

  Fly    85 WPQTNLRTGIVKAITEQLSYGPFACVSFFMGMSLLELKTFSQAVEETKEKAAPTYKVGVCIWPIL 149
            :|.:.....|.|...:||...|....:|:.|:|||:.:  |...:..|||..||||.||..|.:.
 Frog    73 FPGSAPLNVIRKVACDQLMAAPITISAFYTGLSLLDGE--SDIFKNLKEKFWPTYKTGVMCWTVF 135

  Fly   150 QTINFSLVPEHNRVVFVSICSLMWTIFLAYMKTHHEEQSNSAVL 193
            ||||||::|...|..::.:|:.:||.||.|::.....:..|.:|
 Frog   136 QTINFSVIPPFVRTAYIGVCAFLWTTFLCYIRNRDINEVTSRLL 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14777NP_001162634.1 Mpv17_PMP22 118..181 CDD:282035 27/62 (44%)
mpv17lXP_002938322.1 Mpv17_PMP22 105..164 CDD:367825 26/60 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1301408at2759
OrthoFinder 1 1.000 - - FOG0002289
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11266
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1515
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.