DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ns3 and GNL3L

DIOPT Version :9

Sequence 1:NP_001284779.1 Gene:Ns3 / 31097 FlyBaseID:FBgn0266284 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_001171748.1 Gene:GNL3L / 54552 HGNCID:25553 Length:582 Species:Homo sapiens


Alignment Length:496 Identity:125/496 - (25%)
Similarity:209/496 - (42%) Gaps:100/496 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 FVNPK---QRVGLLSKTQEQRMHQKHDEHRDQLKIPRRPKWTKETSAEELVRAENEAFLDWRRDL 144
            ||:|.   .|...|.|...:.|.:|....|:|.:..||   |.|:..::::|.:.|         
Human    46 FVHPNDHANREAELKKKWVEEMREKQQAAREQERQKRR---TIESYCQDVLRRQEE--------- 98

  Fly   145 ALLQEDEEILMTPYEKNL-----------EFWRQLWRVVERSDVVVQIVDARNPLLFRSADLERY 198
              .:..||:|.   |.|:           .::::..:|||.|||:::::|||:||..|...:|..
Human    99 --FEHKEEVLQ---ELNMFPQLDDEATRKAYYKEFRKVVEYSDVILEVLDARDPLGCRCFQMEEA 158

  Fly   199 VKEVEPSKMNMILVNKSDLLTEEQRRHWAEYFDSEGIRTAFYSATLVEEELKREAEECLDSFPEV 263
            |...:.:|..::::||.||:.:|....|.:|..:|....||.::|.                .:|
Human   159 VLRAQGNKKLVLVLNKIDLVPKEVVEKWLDYLRNELPTVAFKASTQ----------------HQV 207

  Fly   264 QQLRRAVEEIKQSLDSVEDALNVIEQKYKTIPETQNDELPRLPGDKNSPRLLSRLELIEFLRNIY 328
            :.|.|....:.|:.:|:        .|.|.....:|                    |:..|.| |
Human   208 KNLNRCSVPVDQASESL--------LKSKACFGAEN--------------------LMRVLGN-Y 243

  Fly   329 TGPRHTEQHVTVGMVGYPNVGKSSTINSLMTVKKVSVSATPGKTKRFQTLFLDKDILLCDCPGLV 393
            ........|:.||:||.|||||||.||||...:..||.|.||.||..|.::|||.|.|.|.||:|
Human   244 CRLGEVRTHIRVGVVGLPNVGKSSLINSLKRSRACSVGAVPGITKFMQEVYLDKFIRLLDAPGIV 308

  Fly   394 M-PSFVLTKADMLLNGILPIDQMRDHVPAVNLLCERIPRHVLEDKYGIVIAKPLEGEDMERPPHS 457
            . |:   ::...:|...:.:.::.|.|..|..:.:|.....:.:.||:      .|...     :
Human   309 PGPN---SEVGTILRNCVHVQKLADPVTPVETILQRCNLEEISNYYGV------SGFQT-----T 359

  Fly   458 EELLLAYGYNRGFMTSNGQPDQARSARYVLKDYVNGRLLYAMSPPSVPQTEYHTFPERQRRVIEE 522
            |..|.|..:..|.....|...|.::|:.||.|:|:|::.:.:.||:......|...|..:.:.|.
Human   360 EHFLTAVAHRLGKKKKGGLYSQEQAAKAVLADWVSGKISFYIPPPATHTLPTHLSAEIVKEMTEV 424

  Fly   523 SQLPGQQQRAMRINKSTSK-----ELDNQFFSDKPTHAHVK 558
            ..:...:|    .|:.|.:     |.|.......|....:|
Human   425 FDIEDTEQ----ANEDTMECLATGESDELLGDTDPLEMEIK 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ns3NP_001284779.1 RbgA 161..524 CDD:224083 98/374 (26%)
HSR1_MMR1 164..395 CDD:206750 71/231 (31%)
p10 <270..312 CDD:177631 5/41 (12%)
P-loop_NTPase 313..>357 CDD:304359 18/43 (42%)
GNL3LNP_001171748.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..58 4/11 (36%)
Required for nucleolar localization 9..35
Nucleostemin_like 136..307 CDD:206753 65/215 (30%)
MnmE_helical 251..>405 CDD:331155 55/167 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1161
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.