DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ns3 and CG17141

DIOPT Version :9

Sequence 1:NP_001284779.1 Gene:Ns3 / 31097 FlyBaseID:FBgn0266284 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_651094.2 Gene:CG17141 / 42697 FlyBaseID:FBgn0039020 Length:323 Species:Drosophila melanogaster


Alignment Length:280 Identity:73/280 - (26%)
Similarity:115/280 - (41%) Gaps:92/280 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 RQLWRVVERSDVVVQIVDARNPLLFRSADLERYVKEVEPS--KMNMILVNKSDLLTEEQRRHWAE 228
            ||:.:.:...|.:|:|.|||.||..|::   ::...:..|  |.:::::||.|||..:|::    
  Fly    32 RQIQQKLRNVDCIVEIHDARIPLAGRNS---QFFDTITGSGVKPHILVLNKVDLLGAKQQK---- 89

  Fly   229 YFDSEGIRTAFYSATLVEEELKREAEECLDSFPEVQQLRRAVEEIKQSLDSVEDALNVIEQKYKT 293
                                            ..:|||||...|::..|.:     |..:|:   
  Fly    90 --------------------------------SVLQQLRRQQPELQHILFT-----NCKDQR--- 114

  Fly   294 IPETQNDELPRLPGDKNSPRLLSRLELIEFLRNIYTGPRHTEQHVTVGMVGYPNVGKSSTINSLM 358
                .|..|..||   .:.||:|  |...|.|.      ...:| .:.::|.|||||||.||.|.
  Fly   115 ----NNGVLDILP---LATRLVS--ESSRFNRT------QAAEH-NLMIIGVPNVGKSSVINVLR 163

  Fly   359 TV--KKVS---VSATPGKTK------RFQTLFLDKDILLCDCPGLVMPSFVLTKAD-----MLLN 407
            .|  ||.|   |.|..|.|:      :.|.   :..:.:.|.||::.||.   |.|     :.|.
  Fly   164 NVHLKKKSAARVGAEAGITRSVGERIKIQE---NPPVYMIDTPGILQPSI---KDDEMGMKLALV 222

  Fly   408 GILPIDQMRDHVPAVNLLCE 427
            |.||     ||:...:|:.:
  Fly   223 GCLP-----DHIVGEDLIAD 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ns3NP_001284779.1 RbgA 161..524 CDD:224083 73/280 (26%)
HSR1_MMR1 164..395 CDD:206750 62/241 (26%)
p10 <270..312 CDD:177631 8/41 (20%)
P-loop_NTPase 313..>357 CDD:304359 17/43 (40%)
CG17141NP_651094.2 GTPase_YlqF 20..317 CDD:274669 73/280 (26%)
YlqF 22..206 CDD:206749 62/239 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435329
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1161
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.