DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ns3 and Mtg1

DIOPT Version :9

Sequence 1:NP_001284779.1 Gene:Ns3 / 31097 FlyBaseID:FBgn0266284 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_955005.2 Gene:Mtg1 / 212508 MGIID:2685015 Length:326 Species:Mus musculus


Alignment Length:389 Identity:80/389 - (20%)
Similarity:134/389 - (34%) Gaps:131/389 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 LEFWRQLWRVVERS----------------------------------DVVVQIVDARNPLLFRS 192
            :..|.|.|..|..:                                  |.|:::.|||.|...|:
Mouse     1 MRLWPQAWGAVRGAWRECFPLQGHDVARWFPGHMAKGLKKMQSSLKSVDCVIEVHDARIPFSGRN 65

  Fly   193 ADLERYVKEVEPSKMNMILVNKSDL--LTEEQRRHWAEYFDSEGIRTAFYSATLVEEELKREAEE 255
            .    ..:|:...|.:::::||.||  |||:|:  ..:..:.:|:....::..:.:|.:|     
Mouse    66 P----LFQELLGLKPHLLVLNKMDLADLTEQQK--IVQRLEEKGLSNVLFTNCVKDENIK----- 119

  Fly   256 CLDSFPEVQQLRRAVEEIKQSLDSVEDALNVIEQKYKTIPETQNDELPRLPGDKNSPRLLSRLEL 320
                                                :.:|                       ::
Mouse   120 ------------------------------------QIVP-----------------------KV 125

  Fly   321 IEFLRNIYTGPRHTEQHVTVGMVGYPNVGKSSTINS-----LMTVKKVSVSATPGKTK----RFQ 376
            :|.:|..|...|.......:.:||.|||||||.|||     |.|.|...|...||.|:    |.|
Mouse   126 MELIRCSYRYHRAETPEYCIMVVGVPNVGKSSLINSLRRQHLRTGKAARVGGEPGITRAVTSRIQ 190

  Fly   377 TLFLDKD-ILLCDCPGLVMPSF--VLTKADMLLNGILPIDQMRDHVPAVNLLCERIPRHVLEDKY 438
            .  .::. :.|.|.||::.|..  |.|...:.|.|.: :|.:.......:.|...:.||.|   :
Mouse   191 V--CERPLVFLLDTPGVLAPRIESVETGLKLALCGTV-LDHLVGEETMADYLLYTLNRHGL---F 249

  Fly   439 GIVIAKPLEG--EDMERPPHSEELLLAYGYNRGFMTSNG-----QPDQARSARYVLKDYVNGRL 495
            |.|....|..  :.:|....:..:.|........:|..|     |||.|.:||..|:.:.:|.|
Mouse   250 GYVQHYALASACDQIEWVLKNVAIKLRKTRKVKVLTGTGNVNVIQPDYAMAARDFLRTFRSGLL 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ns3NP_001284779.1 RbgA 161..524 CDD:224083 80/389 (21%)
HSR1_MMR1 164..395 CDD:206750 54/276 (20%)
p10 <270..312 CDD:177631 1/41 (2%)
P-loop_NTPase 313..>357 CDD:304359 16/48 (33%)
Mtg1NP_955005.2 GTPase_YlqF 29..319 CDD:274669 76/361 (21%)
YlqF 29..206 CDD:206749 50/248 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1161
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.