DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ns3 and mtg1

DIOPT Version :9

Sequence 1:NP_001284779.1 Gene:Ns3 / 31097 FlyBaseID:FBgn0266284 Length:606 Species:Drosophila melanogaster
Sequence 2:XP_021336162.1 Gene:mtg1 / 100150980 ZFINID:ZDB-GENE-031110-2 Length:319 Species:Danio rerio


Alignment Length:308 Identity:66/308 - (21%)
Similarity:123/308 - (39%) Gaps:97/308 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 EKNLEFW---------RQLWRVVERSDVVVQIVDARNPLLFRSADLERYVKEVEPSKMNMILVNK 214
            |:::..|         :|:...:...|.:::|.|||.|...|::..:..: :|.|   :::::||
Zfish    21 ERDVTHWFPRHMAKGLKQMRANLRNVDCIIEIHDARIPFSGRNSSFQESL-DVRP---HLLVLNK 81

  Fly   215 SDLLTEEQRRHWAEYFDSEGIRTAFYSATLVEEELKREAEECLDSFPEVQQLRRAVEEIKQSLDS 279
            .|:....:::...:.|:.||::...::             :|         ||:..|.:|     
Zfish    82 MDVADISKKQSILKQFEREGVKNVLFT-------------DC---------LRQHDENVK----- 119

  Fly   280 VEDALNVIEQKYKTIPETQNDELPRLPGDKNSPRLLSRLELIEFLRNIYTGPRHTEQHVTVGMVG 344
                        |.:|                  |:|:  |||.....:   |..|:...:.::|
Zfish   120 ------------KIVP------------------LVSK--LIESTSRFH---REEERCYCLMVIG 149

  Fly   345 YPNVGKSSTINSLMTV-----KKVSVSATPGKTKRFQTLF--LDKDIL-LCDCPGLVMPSF--VL 399
            .|||||||.||:|...     |...|.|.||.||...|..  .::.|: |.|.||::.|..  :.
Zfish   150 VPNVGKSSLINALRRTYLKKGKASKVGAEPGITKAVLTKIQVCERPIIHLLDTPGVLPPRIENIE 214

  Fly   400 TKADMLLNGILPIDQMRDHVPAVNLLCE-------RIPRHVLEDKYGI 440
            |...:.|.|     .:.||:...:::.:       |:.|....:||.:
Zfish   215 TGMKLALCG-----TVLDHLVGEDVIADFLLFSLNRLERFSYVEKYSL 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ns3NP_001284779.1 RbgA 161..524 CDD:224083 65/306 (21%)
HSR1_MMR1 164..395 CDD:206750 55/247 (22%)
p10 <270..312 CDD:177631 4/41 (10%)
P-loop_NTPase 313..>357 CDD:304359 17/43 (40%)
mtg1XP_021336162.1 RbgA 26..319 CDD:331156 65/303 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1161
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.