DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ns3 and mtg1

DIOPT Version :9

Sequence 1:NP_001284779.1 Gene:Ns3 / 31097 FlyBaseID:FBgn0266284 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_001106634.1 Gene:mtg1 / 100127874 XenbaseID:XB-GENE-957647 Length:311 Species:Xenopus tropicalis


Alignment Length:330 Identity:64/330 - (19%)
Similarity:121/330 - (36%) Gaps:110/330 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 EKNLEFW---------RQLWRVVERSDVVVQIVDARNPLLFRSADLERYVKEVEPSKMNMILVNK 214
            |:.:..|         :|:...::..|.:|::.|||.||..|:.    ..::....|.:::::||
 Frog    15 EREVAHWFPGHMAKGLKQMKTKLKNLDCIVEVHDARIPLSGRNP----IFQDSLGMKPHLLILNK 75

  Fly   215 SDLLTEEQRRHWAEYFDSEGIRTAFYSATLVEEELKREAEECLDSFPEVQQLRRAVEEIKQSLDS 279
            .||....|::........:|:....::             :|:..    |.::..|..|.:    
 Frog    76 MDLADLTQKKRILAQLKQQGVGNVIFT-------------DCVKD----QNIKHVVPVISE---- 119

  Fly   280 VEDALNVIEQKYKTIPETQNDELPRLPGDKNSPRLLSRLELIEFLRNIYTGPRHTEQH--VTVGM 342
                |....|::                                         |.|::  ..:.:
 Frog   120 ----LVGCSQRF-----------------------------------------HREENTETCIMV 139

  Fly   343 VGYPNVGKSSTINSLMTV-----KKVSVSATPGKTKRFQTLFLDKD---ILLCDCPGLVMPSFVL 399
            :|.|||||||.||:|..:     |...|.|.||.|:...|.....:   |.|.|.||::.|....
 Frog   140 IGVPNVGKSSLINALRRMHLRKGKASRVGAEPGITRSVLTKIQVSESPLIFLFDTPGVLSPRIES 204

  Fly   400 TKADM-------LLNGILPIDQMRDHVPAVNLLCERIPRHVLEDKYGIVIAKPLEGEDMERPPHS 457
            .:..|       :|:.::..|.|.|::  :.:|.::: :|...:.||           :|:|...
 Frog   205 VETGMKLALCGTILDHLVGEDIMADYL--LYILNQQM-QHRYVEHYG-----------LEKPCAD 255

  Fly   458 EELLL 462
            .|.||
 Frog   256 IETLL 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ns3NP_001284779.1 RbgA 161..524 CDD:224083 63/328 (19%)
HSR1_MMR1 164..395 CDD:206750 48/249 (19%)
p10 <270..312 CDD:177631 4/41 (10%)
P-loop_NTPase 313..>357 CDD:304359 12/45 (27%)
mtg1NP_001106634.1 GTPase_YlqF 20..311 CDD:274669 63/325 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.