DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14787 and Echs1

DIOPT Version :10

Sequence 1:NP_569914.2 Gene:CG14787 / 31096 FlyBaseID:FBgn0027793 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_444349.1 Gene:Echs1 / 93747 MGIID:2136460 Length:290 Species:Mus musculus


Alignment Length:59 Identity:13/59 - (22%)
Similarity:24/59 - (40%) Gaps:6/59 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 NYIESAIFKFDDSCEPLEEPRKPEVAKCYEPSTSLPKTLEEYRAMGYDWGEFVHDDKAD 78
            |:|.:..|...:..  |.|.::.||    :|.:|.|..::......:.....:|.|..|
Mouse   323 NHITATYFLLAERI--LREKQEKEV----QPRSSSPSNIKAQFRQSWPTKNDLHQDIED 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14787NP_569914.2 crotonase-like 13..216 CDD:474030 13/59 (22%)
Echs1NP_444349.1 crotonase-like 32..288 CDD:474030
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.