DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14787 and AT1G06550

DIOPT Version :10

Sequence 1:NP_569914.2 Gene:CG14787 / 31096 FlyBaseID:FBgn0027793 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_172142.2 Gene:AT1G06550 / 837166 AraportID:AT1G06550 Length:387 Species:Arabidopsis thaliana


Alignment Length:151 Identity:29/151 - (19%)
Similarity:58/151 - (38%) Gaps:33/151 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LVVEQRSGLLHIRFQRRWQR------RTLYELMRALDLASADAAVKVVVLSG---EFSAACGGEM 68
            :|:.:..|.:.:....|.::      ..:::|...|:|...|...|::::.|   .|||  ||::
plant    12 VVIGEEKGSVRLTTLNRPRQLNVISPEVVFKLAEYLELWEKDDQTKLILIKGTGRAFSA--GGDL 74

  Fly    69 EPLALKQGLENRSRRTASHEEAVGSGDAEEQYIHEKAANFVMRSLAKKLLVHRKLLVAFVERQCV 133
            :  ....|.|::.    |..|.|                :.|..|...:..::|..|:.|....:
plant    75 K--VFYHGQESKD----SCLEVV----------------YRMYWLCYHIHTYKKTQVSLVNGISM 117

  Fly   134 GLGLSVCSLCDLVFATELSAF 154
            |.|.::.........||.:.|
plant   118 GGGAALMVPMKFSVVTEKTVF 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14787NP_569914.2 crotonase-like 13..216 CDD:474030 29/151 (19%)
AT1G06550NP_172142.2 PLN02874 1..380 CDD:178462 29/151 (19%)

Return to query results.
Submit another query.