DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14787 and Cdyl

DIOPT Version :10

Sequence 1:NP_569914.2 Gene:CG14787 / 31096 FlyBaseID:FBgn0027793 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_017456089.1 Gene:Cdyl / 361237 RGDID:1549745 Length:617 Species:Rattus norvegicus


Alignment Length:220 Identity:52/220 - (23%)
Similarity:91/220 - (41%) Gaps:46/220 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ESCKHFRELVVEQRSGLLHIRFQRRWQR------RTLYELMRALDLASADAAVKVVVLSGEFSAA 63
            ||...:|::||.::.|..||....:...      ..:.|:..||..|:||.: |:|:||...|..
  Rat   355 ESAYRYRDIVVRKQDGFTHILLSTKSSENNSLNPEVMKEVQSALSTAAADDS-KLVLLSAVGSVF 418

  Fly    64 CGGEMEPLALKQGLENRSRRTASHEEAVGSGDAEEQYIHEKAANFVMRSLAKKLLVHRKLLVAFV 128
            |.|......:::..::|.|.:....||:                   |:.....:..:|.::..|
  Rat   419 CCGLDFIYFIRRLTDDRKRESTKMAEAI-------------------RNFVNTFIQFKKPIIVAV 464

  Fly   129 ERQCVGLGLSVCSLCDLVFATELSAFVPAFSHL----DPCTKVGPGWTVPHV------HWLLRLG 183
            ....:|||.|:..|||:|:|.|.:.|...::..    |.|:.|    ..|.:      :.:|..|
  Rat   465 NGPAIGLGASILPLCDVVWANEKAWFQTPYTTFGQSPDGCSTV----MFPKIMGGASANEMLLSG 525

  Fly   184 DQASSSIALQCGLVASVVREPQEFW 208
            .:.::..|...|||:.|      ||
  Rat   526 RKLTAQEACGKGLVSQV------FW 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14787NP_569914.2 crotonase-like 13..216 CDD:474030 49/212 (23%)
CdylXP_017456089.1 CD_CDY 56..105 CDD:349284
crotonase-like 363..559 CDD:119339 49/212 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.