DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14787 and CG4592

DIOPT Version :10

Sequence 1:NP_569914.2 Gene:CG14787 / 31096 FlyBaseID:FBgn0027793 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_609324.2 Gene:CG4592 / 34317 FlyBaseID:FBgn0032162 Length:287 Species:Drosophila melanogaster


Alignment Length:205 Identity:49/205 - (23%)
Similarity:70/205 - (34%) Gaps:52/205 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 DAEEQYIHEKAANFVMRSLAKKL----LVHRKLLVAFVER--------QCVGLGLSVCSL----- 142
            |:..|....|:...::.|...|:    |...::|...|||        |.:.|.|.:|.|     
  Fly    68 DSINQIESNKSRGLILTSSNDKVFSAGLDLNEMLNPDVERLRLFWTRFQDLWLALHLCGLPTAAA 132

  Fly   143 ---------CDLVFATELSAFVPAF---SHLDPCTKVGPGW-------TVPH--VHWLLRLGDQA 186
                     |.|..|.|....:|..   .|....:.|...|       .:|.  |...|..|...
  Fly   133 INGHSPAAGCVLATACEYRVMLPNLFIGIHATRFSFVISKWMMNSYQSVLPRRIVERALNQGKLF 197

  Fly   187 SSSIALQCGLVASVVREPQEFWHRVDQYLRL-----PSASLLATKRLLFRPWQDSLL----AELR 242
            :|..||..|||..:....:|...:...::..     |.|..| |||:...|....||    |:|:
  Fly   198 ASQEALDVGLVDEIACSKEEALSKCAAFIATFDKTNPVARCL-TKRMCREPDVRELLQDRAADLK 261

  Fly   243 E----EGTPL 248
            |    ..|||
  Fly   262 ECVDYVTTPL 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14787NP_569914.2 crotonase-like 13..216 CDD:474030 34/158 (22%)
CG4592NP_609324.2 crotonase-like 43..287 CDD:474030 49/205 (24%)

Return to query results.
Submit another query.