DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14787 and CG4598

DIOPT Version :10

Sequence 1:NP_569914.2 Gene:CG14787 / 31096 FlyBaseID:FBgn0027793 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_609322.1 Gene:CG4598 / 34315 FlyBaseID:FBgn0032160 Length:281 Species:Drosophila melanogaster


Alignment Length:83 Identity:20/83 - (24%)
Similarity:34/83 - (40%) Gaps:12/83 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 GLSVCSLCDLVFATELSAFVPAFSHLDPCTKVG---PGWTVPHVHWLL--RLGDQA-------SS 188
            |.|....|.|..:.|....||.|:.....|::|   |.|.:.....:|  |:.::|       ::
  Fly   126 GHSPAGGCLLATSCEYRVMVPNFTIGLNETQLGIVAPQWFMASFLSVLPQRIAERALNQGRMFTT 190

  Fly   189 SIALQCGLVASVVREPQE 206
            ..||:.||:.......:|
  Fly   191 EEALKVGLIDETANNKEE 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14787NP_569914.2 crotonase-like 13..216 CDD:474030 20/83 (24%)
CG4598NP_609322.1 crotonase-like 27..217 CDD:119339 20/83 (24%)

Return to query results.
Submit another query.