DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14787 and LOC3292126

DIOPT Version :10

Sequence 1:NP_569914.2 Gene:CG14787 / 31096 FlyBaseID:FBgn0027793 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_554016.3 Gene:LOC3292126 / 3292126 VectorBaseID:AGAMI1_003589 Length:283 Species:Anopheles gambiae


Alignment Length:54 Identity:13/54 - (24%)
Similarity:25/54 - (46%) Gaps:4/54 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 LRLGDQASSSIALQCGLVASVVREPQEFWHRVDQYL-RLPSASLLA---TKRLL 229
            |.||...::..||:.|::..:....::...:...:| |....|.:|   ||:.|
Mosquito   185 LTLGKMYTTDEALKVGMIDEIAENKEKALEQAVAFLNRFRKISPMARAMTKQAL 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14787NP_569914.2 crotonase-like 13..216 CDD:474030 7/36 (19%)
LOC3292126XP_554016.3 crotonase-like 38..278 CDD:474030 13/54 (24%)

Return to query results.
Submit another query.