DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14785 and KEAP1

DIOPT Version :10

Sequence 1:NP_569912.2 Gene:CG14785 / 31094 FlyBaseID:FBgn0027795 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_036421.2 Gene:KEAP1 / 9817 HGNCID:23177 Length:624 Species:Homo sapiens


Alignment Length:189 Identity:37/189 - (19%)
Similarity:60/189 - (31%) Gaps:84/189 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   284 FLYFTEHELTHILRNCYLSVNSEIEIFLSVVLWLEHNWLERGDCAERILAEVHFALMPTWYLCTL 348
            |...:..:|..::....|:|..|.|:|.:.:.|:::      ||.:|           .:|:..|
Human   220 FFNLSHCQLVTLISRDDLNVRCESEVFHACINWVKY------DCEQR-----------RFYVQAL 267

  Fly   349 DRSNRCNHFARVIHSPGVQRLIAAGLEDAITLKSKPRFSGAALHRQRKHQEERLLVRDWIVDTEC 413
            .|:.||       ||              :|    |.|      .|.:.|:..:|..|       
Human   268 LRAVRC-------HS--------------LT----PNF------LQMQLQKCEILQSD------- 294

  Fly   414 SHHHKSHCEQFVYPTYDAFKEYLARII-------------CCAPNCWRTFRPAQEVYRR 459
                 |.|           |:||.:|.             |.||...|....|...:|:
Human   295 -----SRC-----------KDYLVKIFEELTLHKPTQVMPCRAPKVGRLIYTAGGYFRQ 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14785NP_569912.2 BACK 256..345 CDD:197943 11/60 (18%)
DUF4734 359..450 CDD:434992 19/103 (18%)
KEAP1NP_036421.2 BTB_POZ_KLHL19_KEAP1 56..180 CDD:349557
PHA03098 95..596 CDD:222983 37/189 (20%)
Kelch 1 327..372 2/11 (18%)
KELCH repeat 362..409 CDD:276965
Kelch 2 373..423
KELCH repeat 413..456 CDD:276965
Kelch 3 424..470
KELCH repeat 460..503 CDD:276965
Kelch 4 471..517
KELCH repeat 507..551 CDD:276965
Kelch 5 518..564
KELCH repeat 554..597 CDD:276965
Kelch 6 565..611
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.