DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14785 and Klhl28

DIOPT Version :10

Sequence 1:NP_569912.2 Gene:CG14785 / 31094 FlyBaseID:FBgn0027795 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_079983.1 Gene:Klhl28 / 66689 MGIID:1913939 Length:571 Species:Mus musculus


Alignment Length:256 Identity:53/256 - (20%)
Similarity:95/256 - (37%) Gaps:70/256 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 SEQL---LHVLRE-QTLMEAGIFVGNERYRFFKGVLQNYAKIYAARKFIDKLPK----------L 200
            ||||   |::||: ..|.:..:.||:.:....|.||.:.:..:.| .|...|.:          :
Mouse    18 SEQLLQGLNLLRQHHELCDIILRVGDVKIHAHKVVLASISPYFKA-MFTGNLSEKENSEVEFQCI 81

  Fly   201 DQLGPDAGAERELFARVV-----------AEEVLQIPQLLRQLRSSLSKMEFFNEDTAFKAYLEV 254
            |:....|..|......|.           |..:|||..:|::.                .|:||.
Mouse    82 DEAALQAIVEYAYTGTVFISQDTVESLLPAANLLQIKLVLKEC----------------CAFLES 130

  Fly   255 RYHPQARILCELMLTRISRVFLC----IVGSPF-------------FLYFTEHELTHILRNCYLS 302
            :..|..   | :.::|.:..:.|    :..:.|             |...|..:|..|:.|..|:
Mouse   131 QLDPGN---C-IGISRFAETYGCHDLYLAATKFICQNFESVCQTEEFFELTHADLDEIVSNDCLN 191

  Fly   303 VNSEIEIFLSVVLWLEHNWLERGDCAERILAEVHFALMPTWYLCTLDRSNR-------CNH 356
            |.:|..:|.::..|::::..||.....::|..|...|:...:|..|..:|.       |.|
Mouse   192 VATEETVFYALESWIKYDVQERQKYLAQLLNSVRLPLLSVKFLTRLYEANHLIRDDRTCKH 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14785NP_569912.2 BACK 256..345 CDD:197943 20/105 (19%)
DUF4734 359..450 CDD:434992
Klhl28NP_079983.1 PHA03098 35..553 CDD:222983 45/239 (19%)
Kelch 1 284..331
KELCH repeat 321..372 CDD:276965
Kelch 2 332..386
KELCH repeat 376..419 CDD:276965
Kelch 3 387..433
KELCH repeat 423..465 CDD:276965
Kelch 4 435..479
KELCH repeat 469..513 CDD:276965
Kelch 5 480..526
KELCH repeat 516..559 CDD:276965
Kelch 6 528..570
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.