DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG14785 and KLHL9

DIOPT Version :9

Sequence 1:	NP_569912.2	Gene:	CG14785 / 31094	FlyBaseID:	FBgn0027795	Length:	470	Species:	Drosophila melanogaster
Sequence 2:	NP_061335.1	Gene:	KLHL9 / 55958	HGNCID:	18732	Length:	617	Species:	Homo sapiens

Alignment Length:	93	Identity:	25/93 - (26%)
Similarity:	41/93 - (44%)	Gaps:	12/93 - (12%)

- Green bases have known domain annotations that are detailed below.

  Fly   271 ISRVFLCIVGSPFFLYFTEHELTHILRNCYLSVNSEIEIFLSVVLWLEHNWLE--RGDCAERILA 333
            |.:.|..::.:..||......|..:|.:..|...:|:|:|.:...||.   ||  |.|.|.:::.
Human   177 ILKNFPALLSTGEFLKLPFERLAFVLSSNSLKHCTELELFKAACRWLR---LEDPRMDYAAKLMK 238

  Fly   334 EVHFALMPTW----YLCTLD---RSNRC 354
            .:.|.||...    |:.|:|   ..|.|
Human   239 NIRFPLMTPQDLINYVQTVDFMRTDNTC 266

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG14785	NP_569912.2	BACK	256..345	CDD:197943	20/79 (25%)
CG14785	NP_569912.2	DUF4734	360..450	CDD:292506
KLHL9	NP_061335.1	BTB_POZ_KLHL9_13	27..154	CDD:349548
		PHA03098	50..593	CDD:222983	25/93 (27%)
		Kelch 1	300..347
		KELCH repeat	337..385	CDD:276965
		Kelch 2	348..399
		KELCH repeat	389..433	CDD:276965
		Kelch 3	400..446
		KELCH repeat	436..481	CDD:276965
		Kelch 4	448..493
		KELCH repeat	483..532	CDD:276965
		Kelch 5	495..545
		KELCH repeat	535..582	CDD:276965
		Kelch 6	546..595
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	595..617
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910