DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14785 and Keap1

DIOPT Version :10

Sequence 1:NP_569912.2 Gene:CG14785 / 31094 FlyBaseID:FBgn0027795 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_732202.2 Gene:Keap1 / 42062 FlyBaseID:FBgn0038475 Length:776 Species:Drosophila melanogaster


Alignment Length:114 Identity:27/114 - (23%)
Similarity:52/114 - (45%) Gaps:6/114 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   271 ISRVFLCIVGSPFFLYFTEHELTHILRNCYLSVNSEIEIFLSVVLWLEHNWLERGDCAERILAEV 335
            |.|.|..:.....||..:.::|..::|...|:|..|.|::.:|:.|::::...|....|.||..|
  Fly   215 IERNFTQVCQEEEFLQLSAYQLIALIRRDELNVQEEREVYNAVLKWVKYDEDNRHCKMEHILGAV 279

  Fly   336 HFALMPTWYLCTLDRSNRCNHFARVIHSPGVQRLIAAGLEDAITLKSKP 384
            ....:...:|  .::...|:...:|   |..:..:|...:| :||...|
  Fly   280 RCQFLTPNFL--KEQMKNCDVLRKV---PACREYLAKIFKD-LTLHKCP 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14785NP_569912.2 BACK 256..345 CDD:197943 18/73 (25%)
DUF4734 359..450 CDD:434992 7/26 (27%)
Keap1NP_732202.2 PHA03098 92..599 CDD:222983 27/114 (24%)
KELCH repeat 369..416 CDD:276965
KELCH repeat 420..463 CDD:276965
KELCH repeat 467..510 CDD:276965
KELCH repeat 514..558 CDD:276965
KELCH repeat 561..606 CDD:276965
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.