DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14785 and CG9970

DIOPT Version :9

Sequence 1:NP_569912.2 Gene:CG14785 / 31094 FlyBaseID:FBgn0027795 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_647754.1 Gene:CG9970 / 38351 FlyBaseID:FBgn0035380 Length:484 Species:Drosophila melanogaster


Alignment Length:452 Identity:106/452 - (23%)
Similarity:176/452 - (38%) Gaps:104/452 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 QQDQLKDKKQDRRPKPEPEKLESGAQGDAGSASSTSAHAVKLLPIEGD--PAKLKALTSRQQIAS 113
            ::|.|:..|.      |.||    .:|.:...|:|:         :||  ..|:..:..:|:...
  Fly    38 EEDLLQQNKS------EKEK----TKGTSTDKSTTT---------DGDLPTVKMDKILQQQRAEL 83

  Fly   114 LLNHLGDGAEGDG-------------------EAKQIVMELLGSGVQPHSAIERVSEQLL-HVLR 158
            |.....|....|.                   ::|..:.|:      |:...:....||: ::|:
  Fly    84 LWKTFTDEEYSDWKTFKDSNYKVPLLSVFSYVKSKPFIAEI------PNLPPKISGPQLMTNILK 142

  Fly   159 EQTLMEAGIFVGNERYRFFKGVLQNYAKIYAAR-------KF------------------IDKLP 198
            ......|.:.:|..:::....:|:.::..:..|       ||                  .:|||
  Fly   143 SNYGALALVQIGENKFKCIPCLLRCFSVWFGIRDWRITRFKFKEREVPSGGFKVVYEWMRTNKLP 207

  Fly   199 KLDQLGPDAGAERELFARVVAEEVLQIPQLLRQLRSSLSKMEFFNEDTAFKAYLEVRYHPQARIL 263
            :.|:|.|.......|...::.:|:.||          ||. |...|..||..||..|..|....|
  Fly   208 EFDELVPALQVACHLKVTLLEKEIWQI----------LSD-ESVREKVAFLVYLGARRMPALGAL 261

  Fly   264 CELMLTRISRVFLCIVGSPFFLYFTEHELTHILRNCYLSVNSEIEIFLSVVLWLEHN-WLERGDC 327
            ||.||.|:.:.||.:||||.|:......|..:||...:.||||:|:|.:|:.||.|: ..:|.:.
  Fly   262 CEAMLFRLRKYFLALVGSPHFVRLKVDVLEMLLRQDSIGVNSEMEVFFAVIRWLGHSRGRKRREH 326

  Fly   328 AERILAEVHFALMPTWYLCTLDRS-NRCNHFARVIHSPGVQRLIAAG--------LEDA---ITL 380
            .:|::..|.|..||..:|.:|..| |....|......||   ::|..        ||.|   |::
  Fly   327 FQRLMKCVRFHHMPMTFLFSLRESFNHPEKFDLFSKEPG---MLAFNTDPEMMELLEHAIYFISV 388

  Fly   381 KSKPRFSGAALHRQRKHQEERLLVRDWIVDTECSHHHKSHCEQFVYP---TYDAFKEYLARI 439
            :::.......|.....|..|.:|.|.|:....|..|.::  ..|.|.   |...|.:|:..|
  Fly   389 RTQCDDINEFLSTCESHHIEVVLPRWWVYHVNCPFHLRT--IDFPYQHRFTATDFGDYIDSI 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14785NP_569912.2 BACK 256..345 CDD:197943 33/89 (37%)
DUF4734 360..450 CDD:292506 21/94 (22%)
CG9970NP_647754.1 BACK 254..346 CDD:197943 34/91 (37%)
DUF4734 373..450 CDD:292506 18/78 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469507
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006713
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22667
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.