DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14785 and CG8260

DIOPT Version :9

Sequence 1:NP_569912.2 Gene:CG14785 / 31094 FlyBaseID:FBgn0027795 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_573069.1 Gene:CG8260 / 32521 FlyBaseID:FBgn0030684 Length:415 Species:Drosophila melanogaster


Alignment Length:230 Identity:56/230 - (24%)
Similarity:111/230 - (48%) Gaps:28/230 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 LQIPQLLRQLRSSLSKMEFFNEDTAFKAYLEVRYHPQARILCELMLTRISRVFLCIVGSPFFLYF 287
            |.||:||....::|.::.|| |.:||:...|:|.......:.:.:..|||...|.:..:..||..
  Fly   173 LDIPELLEACWANLDRITFF-EISAFRLLFELRGATNLWDVFDKLTGRISISILPVASTREFLCL 236

  Fly   288 TEHELTHILRNCYLSVNSEIEI-FLSVVLWLEHNWLERGDCAERILAEVHFALMPTWYLCTL--D 349
            :|.::.:||::.:|::|||:|. .:|:          |.....|:|:::.|:.:|...|...  :
  Fly   237 SETQICYILKSNFLAINSEMEASSISI----------RRSSTYRVLSQIRFSFLPPLMLKKFRSE 291

  Fly   350 RSNRCNHFARVI----HSPGVQRLIAAGLEDA---ITLKSKPRFSGAALHRQRKHQEERLL-VRD 406
            ..::...|:.::    .||.|..|:...:.::   :|:::.|    :.|....:..|..|: .|.
  Fly   292 ELHKMPEFSDILKEFSKSPDVITLLRDSVFNSSLLLTVRNNP----SVLDTHVEFTEVELMEPRH 352

  Fly   407 WIVDTECSHHHK--SHCEQFVYPTYDAFKEYLARI 439
            |:.|..|.:|.|  ..|....:.|.:.::|||.|:
  Fly   353 WVQDHTCDYHRKVTQLCPNMRFITLNEYQEYLKRL 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14785NP_569912.2 BACK 256..345 CDD:197943 20/89 (22%)
DUF4734 360..450 CDD:292506 21/90 (23%)
CG8260NP_573069.1 BTB 91..182 CDD:295341 5/8 (63%)
BTB 97..190 CDD:197585 6/16 (38%)
BACK 200..287 CDD:197943 23/96 (24%)
DUF4734 308..387 CDD:292506 20/82 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469513
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006713
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22667
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.