DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14785 and CG17754

DIOPT Version :10

Sequence 1:NP_569912.2 Gene:CG14785 / 31094 FlyBaseID:FBgn0027795 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_572549.2 Gene:CG17754 / 31873 FlyBaseID:FBgn0030114 Length:654 Species:Drosophila melanogaster


Alignment Length:270 Identity:63/270 - (23%)
Similarity:104/270 - (38%) Gaps:69/270 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 LRQLRSSLSKMEFFN-EDTAFKAYLEVRYHPQARILCELML------TRI--SRVFLCIVGSPFF 284
            |..|.|:.|:.|||. .|.|......::.:..::.||:::|      .|:  .|:.|....:.|.
  Fly    39 LGSLNSAGSQDEFFRCRDHADNILKRMQLYVDSQQLCDVVLIAGIDGKRVPAHRLVLSASSAYFS 103

  Fly   285 LYFT-------EHELT---------HIL-RNCYLSV----NSEIEIFLSVVLWLEHNWLERGDCA 328
            ..||       |.|:|         |:| :.||...    ...:|..|:....|:.|.:... |.
  Fly   104 AMFTGSLRETKEQEVTLGEVHGDALHLLVQYCYTGFIEMREDTVETLLATACLLQLNAVVTA-CC 167

  Fly   329 ERILAEVH------FALMPTWYLCT----LDRSNRCNHFARVIHSPGVQRLIAAGL--------- 374
            ..:..::|      ||.......||    |.::..|.:|.:|..:....:|.|..|         
  Fly   168 NFLARQLHPSNCLGFAFFAEQQSCTTLLRLAQAYTCQYFMQVCQNQEFFQLNADQLGKLLSSDDL 232

  Fly   375 -----EDAI-TLKSKPRFSGAALHRQRKHQEERL-LVR------DWIVDTECSHHHKSHCEQFVY 426
                 :|.. :|.|..|...||   :.:|..|.| |||      .:|:|...:..:.:.|:|.| 
  Fly   233 NVPSEQDVFHSLMSWVRHDSAA---REQHIPELLALVRLPLLQPAFIMDHVENVCNANECQQLV- 293

  Fly   427 PTYDAFKEYL 436
              .:|||.:|
  Fly   294 --MEAFKWHL 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14785NP_569912.2 BACK 256..345 CDD:197943 24/123 (20%)
DUF4734 359..450 CDD:434992 25/100 (25%)
CG17754NP_572549.2 PHA03098 71..591 CDD:222983 54/238 (23%)
KELCH repeat 359..402 CDD:276965
KELCH repeat 406..449 CDD:276965
KELCH repeat 453..497 CDD:276965
KELCH repeat 500..549 CDD:276965
KELCH repeat 553..596 CDD:276965
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.