DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14785 and KLHL40

DIOPT Version :10

Sequence 1:NP_569912.2 Gene:CG14785 / 31094 FlyBaseID:FBgn0027795 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_689606.2 Gene:KLHL40 / 131377 HGNCID:30372 Length:621 Species:Homo sapiens


Alignment Length:70 Identity:18/70 - (25%)
Similarity:30/70 - (42%) Gaps:14/70 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 LDDSLEESDKKDIRDALHEISINTCIL-----FRYN-ATPKGYHLNYMKVDSTTFC-----GLSY 302
            |:||::.|   |:...|..:|..||.|     |:.: ..||.:.:......|.:.|     |:.|
Human   135 LEDSVQSS---DLGSDLELLSDTTCPLESEAEFQSDPQIPKPFPVTKGSPKSASVCSGSVDGVEY 196

  Fly   303 VGRTD 307
            ..|.:
Human   197 SERKE 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14785NP_569912.2 BACK 256..345 CDD:197943 15/63 (24%)
DUF4734 359..450 CDD:434992
KLHL40NP_689606.2 BTB_POZ_KLHL40_KBTBD5 6..137 CDD:349649 1/1 (100%)
PHA03098 47..551 CDD:222983 18/70 (26%)
BACK 128..230 CDD:475122 18/70 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 265..295
KELCH repeat 351..398 CDD:276965
Kelch 1 360..412
KELCH repeat 402..448 CDD:276965
Kelch 2 413..462
KELCH repeat 452..497 CDD:276965
Kelch 3 463..510
Kelch 4 512..557
Kelch_1 547..594 CDD:396078
KELCH repeat 547..594 CDD:276965
Kelch 5 559..613
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.