DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14785 and keap1b

DIOPT Version :10

Sequence 1:NP_569912.2 Gene:CG14785 / 31094 FlyBaseID:FBgn0027795 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_001106948.1 Gene:keap1b / 100003679 ZFINID:ZDB-GENE-080508-1 Length:593 Species:Danio rerio


Alignment Length:133 Identity:31/133 - (23%)
Similarity:53/133 - (39%) Gaps:26/133 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 HPQARILCELMLTRISRVFLCIVGSPFFLYFTEHELTHILRNCYLSVNSEIEIFLSVVLWLEHNW 321
            |.:||   |.:....|:|    .....|...:..:|..::....|:|..|.|:|.:.|.|::::.
Zfish   174 HQKAR---EYIYMNFSQV----ATQEEFFTLSHCQLVTLISRDELNVRCESEVFHACVAWVQYDR 231

  Fly   322 LERGDCAERILAEVH-FALMP----------TW------YLCTLDRSNRCNHFARVI--HSPGVQ 367
            .||....:.:|..|. .:|.|          .|      ||..:.|....:...:||  .:|.|.
Zfish   232 EERRPYVQALLQAVRCHSLTPHFLQRQLEHFEWDAQSKDYLSQIFRDLTLHKPTKVIPLRTPKVP 296

  Fly   368 RLI 370
            :||
Zfish   297 QLI 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14785NP_569912.2 BACK 256..345 CDD:197943 22/104 (21%)
DUF4734 359..450 CDD:434992 6/14 (43%)
keap1bNP_001106948.1 BTB_POZ_KLHL19_KEAP1 29..154 CDD:349557
PHA03098 69..563 CDD:222983 31/133 (23%)
BACK_KLHL19_KEAP1 152..242 CDD:350533 17/74 (23%)
KELCH repeat 333..380 CDD:276965
KELCH repeat 384..427 CDD:276965
KELCH repeat 431..474 CDD:276965
KELCH repeat 478..522 CDD:276965
KELCH repeat 525..570 CDD:276965
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.