DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr2a and Gr98a

DIOPT Version :9

Sequence 1:NP_001162633.1 Gene:Gr2a / 31093 FlyBaseID:FBgn0265139 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_651564.1 Gene:Gr98a / 43305 FlyBaseID:FBgn0039520 Length:391 Species:Drosophila melanogaster


Alignment Length:388 Identity:68/388 - (17%)
Similarity:150/388 - (38%) Gaps:73/388 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 WTVLIAATSFTVYGLFQESSVEEKQDSESTISSIGHTVDFIQLVGMRVAHLAALLEALWQRQAQR 110
            :.:|..:..|:.|..|   |.:.:.|.:........|:|....|.:.:.|...:||.||...:: 
  Fly    39 YVLLFVSLGFSSYWRF---SFDYEFDYDFLNDRFSSTIDLSNFVALVLGHAIIVLELLWGNCSK- 99

  Fly   111 GFFAELGEIDRLLSKAL--RVDVEAMRINMRRQTSRRAVWILWGYAVSQLLILGAKLLSRGDRFP 173
                   ::||.| :|:  ::.::....|...:..|...||.....:..|:.:...:.|  :|..
  Fly   100 -------DVDRQL-QAIHSQIKLQLGTSNSTDRVRRYCNWIYGSLIIRWLIFIVVTIYS--NRAL 154

  Fly   174 IYWISYLLPLLVCGLRYFQIFNATQLVRQRLDVLLVALQQLQLHQKGPAVDTVLE-------EQE 231
            ....:|...:.:.....|.::.|         |:|...|:|.:     ....||:       |..
  Fly   155 TINATYSELVFLARFSEFTLYCA---------VILFIYQELIV-----GGSNVLDELYRTRYEMW 205

  Fly   232 DLEEAAMDRLIAVRLVYQRVWALVALLNRCYGLSMLMQVGNDFLAITSNCYWMFLN-------FR 289
            .:...::.:|..::.::..:|..:..|...:.||::..:...|:..::..||::|:       ..
  Fly   206 SIRRLSLQKLAKLQAIHNSLWQAIRCLECYFQLSLITLLMKFFIDTSALPYWLYLSRVEHTRVAV 270

  Fly   290 QSAASPFDILQIVASGVWSAPHLGNVLVLSLLCDRTAQCASRLALCLHQVSVDLRNESHNALVGT 354
            |...:..:.::::           .::|...||.|......:.....:.|:.|.|:...||.:.:
  Fly   271 QHYVATVECIKLL-----------EIVVPCYLCTRCDAMQRKFLSMFYTVTTDRRSSQLNAALRS 324

  Fly   355 LVRYCAPLIILVPLQITQFSLQLLHQRLHFSAAGFFNVDCTLLYTIVGATTTYLIILIQFHMS 417
            |                  :|||..::..|||.|..:::..:|........:|::|.|||.::
  Fly   325 L------------------NLQLSQEKYKFSAGGMVDINTEMLGKFFFGMISYIVICIQFSIN 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr2aNP_001162633.1 7tm_7 7..418 CDD:285581 68/388 (18%)
Gr98aNP_651564.1 7tm_7 13..370 CDD:285581 68/388 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.