DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr2a and Gr68a

DIOPT Version :9

Sequence 1:NP_001162633.1 Gene:Gr2a / 31093 FlyBaseID:FBgn0265139 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_524027.2 Gene:Gr68a / 39324 FlyBaseID:FBgn0041231 Length:389 Species:Drosophila melanogaster


Alignment Length:436 Identity:92/436 - (21%)
Similarity:163/436 - (37%) Gaps:71/436 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDTLRALEPLHRACQVCNLWPWRLAPPPDS---EGILLRRSRWL-ELYGWTVLIAATSFTVYGLF 61
            |...:.:.|:.:..|:..:.|:......|.   .|:    .||. .|....:||.:.:.....||
  Fly     1 MKIYQDIYPISKPSQIFAILPFYSGDVDDGFRFGGL----GRWYGRLVALIILIGSLTLGEDVLF 61

  Fly    62 QESSVEEKQDSESTISSIGHTVDFIQLVGMRVAHLAALLEALWQRQAQRGF--FAELGEIDR-LL 123
            ..........::.....|..|::.:..:   :::...:|.::  :.|.|.|  ..::.:||. ||
  Fly    62 ASKEYRLVASAQGDTEEINRTIETLLCI---ISYTMVVLSSV--QNASRHFRTLHDIAKIDEYLL 121

  Fly   124 SKALRVDVEAMRINMRRQTSRRAVWILWGYAVSQLLILGAKLLSRGDRFPIYWISYLLPLLVCGL 188
            :...|.......:.:...::...|..:..|.:.....:|||      |..|..:.|.|.||...|
  Fly   122 ANGFRETYSCRNLTILVTSAAGGVLAVAFYYIHYRSGIGAK------RQIILLLIYFLQLLYSTL 180

  Fly   189 RYFQIFNATQLVRQRLDVLLVALQQLQLHQKGPAVDTVLEEQEDLEEAAMDRLIAVRLVYQRVWA 253
            ....:......:.||:..|...|....|...|        ..|:..|  :..||.|...::.:  
  Fly   181 LALYLRTLMMNLAQRIGFLNQKLDTFNLQDCG--------HMENWRE--LSNLIEVLCKFRYI-- 233

  Fly   254 LVALLNRCYGLSMLMQVGNDFLAITSNCYWMFLNFRQ-SAASPFDILQIVA-SGVWSAPHLGNVL 316
             ...:|...|:|:|...|..|..:|:..|..|..... |.:|..::...:. |.:|.......::
  Fly   234 -TENINCVAGVSLLFYFGFSFYTVTNQSYLAFATLTAGSLSSKTEVADTIGLSCIWVLAETITMI 297

  Fly   317 VLSLLCD-------RTAQCASRLALCLHQVSVDLRNESHNALVGTLVRYCAPLIILVPLQITQFS 374
            |:...||       .|||..:|    ::..|...:|                       .|.:|.
  Fly   298 VICSACDGLASEVNGTAQILAR----IYGKSKQFQN-----------------------LIDKFL 335

  Fly   375 LQLLHQRLHFSAAGFFNVDCTLLYTIVGATTTYLIILIQFHMSEST 420
            .:.:.|.|.|:|.|||::|.:.|:.|..|.||||:|||||...|.:
  Fly   336 TKSIKQDLQFTAYGFFSIDNSTLFKIFSAVTTYLVILIQFKQLEDS 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr2aNP_001162633.1 7tm_7 7..418 CDD:285581 90/426 (21%)
Gr68aNP_524027.2 7tm_7 7..379 CDD:285581 90/426 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450293
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.