DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr2a and Gr59f

DIOPT Version :9

Sequence 1:NP_001162633.1 Gene:Gr2a / 31093 FlyBaseID:FBgn0265139 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster


Alignment Length:460 Identity:82/460 - (17%)
Similarity:150/460 - (32%) Gaps:159/460 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RWLELYG---WTVLIAATSFTV------------------------YGLFQESSVEEKQDSESTI 76
            |:.|||.   |.:||:..:.|.                        ||||               
  Fly    29 RYKELYRTLFWLLLISVLANTAPITILPGCPNRFYRLVHLSWMILWYGLF--------------- 78

  Fly    77 SSIGHTVDFIQLVGMRVA---------------HLAALLEALWQ-RQAQRGFFAELGEIDRLLSK 125
             .:|...:|:.:...||:               |:.:::...|| |.........:...|  |::
  Fly    79 -VLGSYWEFVLVTTQRVSLDRYLNAIESAIYVVHIFSIMLLTWQCRNWAPKLMTNIVTSD--LNR 140

  Fly   126 ALRVDVEAMRINMRRQTSRRAVWI-------LWGYAVSQLLILGAKLLSRGDRFPIYWI-----S 178
            |..:|....:..:|.|.....::.       :|.:                 :|.:|..     |
  Fly   141 AYTIDCNRTKRFIRLQLFLVGIFACLAIFFNIWTH-----------------KFVVYRSILSINS 188

  Fly   179 YLLPLLVCGLRYFQIFNATQLVRQRLDVLLVALQQLQLHQKGPAVDTVLEEQEDLEEAAMDRLIA 243
            |::|.::..:.:.|.:...|.:..|...|...|::...|...|.:..|.:               
  Fly   189 YVMPNIISSISFAQYYLLLQGIAWRQRRLTEGLERELTHLHSPRISEVQK--------------- 238

  Fly   244 VRLVYQRVWALVALLNRCYGLSMLMQVGNDFLAITSNCYWMFLNFR-------QSAASP--FDIL 299
            :|:.:..:......:||.:..|:|:        :...|   ||||.       |...:|  .|..
  Fly   239 IRMHHANLIDFTKAVNRTFQYSILL--------LFVGC---FLNFNLVLFLVYQGIENPSMADFT 292

  Fly   300 QIVASGVWSAPHLGNVLVLSLLCDRTAQCASRLALCLHQVSVDLRNESHNALVGTLVRYCAPLII 364
            :.|...:|.|.|:|.|            |:     .|| .:..::|| |:.        |..|:.
  Fly   293 KWVCMLLWLAMHVGKV------------CS-----ILH-FNQSIQNE-HST--------CLTLLS 330

  Fly   365 LVPL-------QITQFSLQLLHQRLHFSAAGFFNVDCTLLYTIVGATTTYLIILIQFHMSESTIG 422
            .|..       .||.|.:|:..........|..|:|...|.|::.|:..:.|.|:|:.::...:.
  Fly   331 RVSYARKDIQDTITHFIIQMRTNVRQHVVCGVINLDLKFLTTLLVASADFFIFLLQYDVTYEALS 395

  Fly   423 SDSNG 427
            ....|
  Fly   396 KSVQG 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr2aNP_001162633.1 7tm_7 7..418 CDD:285581 81/449 (18%)
Gr59fNP_788432.1 7tm_7 61..388 CDD:303125 73/414 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.