DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr2a and Gr58b

DIOPT Version :9

Sequence 1:NP_001162633.1 Gene:Gr2a / 31093 FlyBaseID:FBgn0265139 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_523808.2 Gene:Gr58b / 37502 FlyBaseID:FBgn0041238 Length:408 Species:Drosophila melanogaster


Alignment Length:372 Identity:71/372 - (19%)
Similarity:139/372 - (37%) Gaps:107/372 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 DFIQLVGMRVAHLAALLEALWQRQAQ--------RGFFAELGEIDR-LLSKALRVDVEAMRINMR 139
            :|..::.:|...:.:....||.::.:        ..::...|.|.| ::.|...:|::.   ::.
  Fly    82 NFFVMLFLRAIAVVSCYGTLWLKRHKIIQLYKYSLIYWKRFGHITRAIVDKKELLDLQE---SLA 143

  Fly   140 RQTSRRAVWILWGYAVSQLLILGAKLLSRGDRFPIYWISYLLPLLVCG-LRYF--------QIFN 195
            |...|:.:.:...:..|  .:|..:|||        .|:..:.|..|. |.:|        ..|.
  Fly   144 RIMIRKIILLYSAFLCS--TVLQYQLLS--------VINPQIFLAFCARLTHFLHFLCVKMGFFG 198

  Fly   196 ATQLVRQRLDVLLVALQQL---QLHQKGPAVDTVLEEQEDLEEAAMDRLIAVRLVYQRVWALVAL 257
            ...|:..:..|:.:|:..|   :..:|..|:.:|         ||| .|..:||. :|::.:..:
  Fly   199 VLVLLNHQFLVIHLAINALHGRKARKKWKALRSV---------AAM-HLKTLRLA-RRIFDMFDI 252

  Fly   258 LNRCYGLSMLM----------QVGNDFLAITSNCYW--MFLNFRQSAASPFDILQIVASGVWSAP 310
            .|....::|.|          |..|.  :|.|| .|  :|.|            .::....|   
  Fly   253 ANATVFINMFMTAINILYHAVQYSNS--SIKSN-GWGILFGN------------GLIVFNFW--- 299

  Fly   311 HLGNVLVLSLL------CDRTAQCASRLALCLHQVSVDLRNESHNALVGTLVRYCAPLIILVPLQ 369
              |.:.::.:|      |:.|.|              .||..|....||..::          .:
  Fly   300 --GTMALMEMLDSVVTSCNNTGQ--------------QLRQLSDLPKVGPKMQ----------RE 338

  Fly   370 ITQFSLQLLHQRLHFSAAGFFNVDCTLLYTIVGATTTYLIILIQFHM 416
            :..|::||...||.:...|...:|.....:.:|:..:.:|||:||.:
  Fly   339 LDVFTMQLRQNRLVYKICGIVELDKPACLSYIGSILSNVIILMQFDL 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr2aNP_001162633.1 7tm_7 7..418 CDD:285581 71/372 (19%)
Gr58bNP_523808.2 7tm_7 12..385 CDD:285581 71/370 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.