DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr2a and Gr33a

DIOPT Version :9

Sequence 1:NP_001162633.1 Gene:Gr2a / 31093 FlyBaseID:FBgn0265139 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_525102.4 Gene:Gr33a / 34641 FlyBaseID:FBgn0032416 Length:475 Species:Drosophila melanogaster


Alignment Length:423 Identity:78/423 - (18%)
Similarity:148/423 - (34%) Gaps:131/423 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 HLAA-------LLEALWQRQAQRGFFAELGEIDRLLSKALRV-DVEAMRIN-MRRQTSRRAVWI- 149
            ||.|       ||....:::..:.|.|.|.:||.::.|..|| :::.:::. ::...:....|: 
  Fly    74 HLGAFLYLTITLLSLYRRKEFFQQFDARLNDIDAVIQKCQRVAEMDKVKVTAVKHSVAYHFTWLF 138

  Fly   150 --------LWGYAVSQLLILGAKLLSRGDRFPIYWIS---YLLPLLVCGLRYFQIFNATQLVRQR 203
                    |: |.|..|.:....|     .|..:.:|   ||...::.|...:.:...:|...| 
  Fly   139 LFCVFTFALY-YDVRSLYLTFGNL-----AFIPFMVSSFPYLAGSIIQGEFIYHVSVISQRFEQ- 196

  Fly   204 LDVLLVALQQLQLHQKGPA---------------------------------------------- 222
            :::||..:.|...|:..|.                                              
  Fly   197 INMLLEKINQEARHRHAPLTVFDIESEGKKERKTVTPITVMDGRTTTGFGNENKFAGEMKRQEGQ 261

  Fly   223 -------VDTVLEEQED---------------LEEAAMDRLIAVRLVYQRVWALVALLNRCYGLS 265
                   :||..:|.||               ..||.:..|..   ::.::.||..:.|..:|..
  Fly   262 QKNDDDDLDTSNDEDEDDFDYDNATIAENTGNTSEANLPDLFK---LHDKILALSVITNGEFGPQ 323

  Fly   266 MLMQVGNDFLAITSNCYWMFL----NFRQSAASPFDILQIVASGVWSAPHLGNVLVLSLLCDRTA 326
            .:..:...|:.   :.:.:||    ||.....|...........:||...:....::..||....
  Fly   324 CVPYMAACFVV---SIFGIFLETKVNFIVGGKSRLLDYMTYLYVIWSFTTMMVAYIVLRLCCNAN 385

  Fly   327 QCASRLALCLHQV-----SVDLRNESHNALVGTLVRYCAPLIILVPLQITQFSLQLLHQR--LHF 384
            ..:.:.|:.:|::     :..|.|:                  |...::..|:||.||..  ..|
  Fly   386 NHSKQSAMIVHEIMQKKPAFMLSND------------------LFYNKMKSFTLQFLHWEGFFQF 432

  Fly   385 SAAGFFNVDCTLLYTIVGATTTYLIILIQFHMS 417
            :..|.|.:|.|.:::.|.|.|:|||:|:||.|:
  Fly   433 NGVGLFALDYTFIFSTVSAATSYLIVLLQFDMT 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr2aNP_001162633.1 7tm_7 7..418 CDD:285581 78/423 (18%)
Gr33aNP_525102.4 7tm_7 <289..465 CDD:303125 41/199 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.