DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr2a and Gr36b

DIOPT Version :9

Sequence 1:NP_001162633.1 Gene:Gr2a / 31093 FlyBaseID:FBgn0265139 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_724039.1 Gene:Gr36b / 117487 FlyBaseID:FBgn0045486 Length:391 Species:Drosophila melanogaster


Alignment Length:422 Identity:81/422 - (19%)
Similarity:144/422 - (34%) Gaps:110/422 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RSRWLELYGW--TVLIAAT---SFTVYG----LFQESSVEEKQDSESTISSIGHTVDFIQLVGMR 92
            :||...:|.:  .:.|..|   :||.:|    |||.::..             |....|.:.|::
  Fly    35 KSRRCTIYAFMANIFILITIIYNFTAHGDTNLLFQSANKL-------------HEYVIIIMSGLK 86

  Fly    93 VAHLAALLEALWQRQAQRGFFAELGEIDRLLSKALRVDVEAMRINMRRQTSRRAVWILWGYAVSQ 157
            :  :|.|:..| .|..||      |::.:|:...:|:    ..||.:.::     .|.||..:..
  Fly    87 I--VAGLITVL-NRWLQR------GQMMQLVKDVIRL----YMINPQLKS-----MIRWGILLKA 133

  Fly   158 LLILGAKLLS---RGDRFPIYWISYLLPLLV--C-----GLRYFQIFNATQLVRQRLDVLLVALQ 212
            .:....:||.   ..|.......:.::.|||  |     .|...|.|....|:|.:..::...|:
  Fly   134 FISFAIELLQVTLSVDALDRQGTAEMMGLLVKLCVSFIMNLAISQHFLVILLIRAQYRIMNAKLR 198

  Fly   213 QLQLHQKGPAVDTVLEEQEDLEEAAM-------------DRLIAVRLVYQRVWALVALLNRCYGL 264
            .            |:||...|....:             |:|..:..|..::.::|..|:..:|:
  Fly   199 M------------VIEESRRLSFLQLRNGAFMTRCCYLSDQLEDIGEVQSQLQSMVGQLDEVFGM 251

  Fly   265 SMLMQVGNDFLAITSNCYWMFL-------NFRQSAASPFDILQIVASGVWSAPHLGNVLVLSLLC 322
            ..||.....:|:|....|..:.       |.:.||.:...:.               :|:.....
  Fly   252 QGLMAYSEYYLSIVGTSYMSYSIYKYGPHNLKLSAKTSIIVC---------------ILITLFYL 301

  Fly   323 DRTAQCASRLALCLHQVSVDLRNESHNALVGTLVR---YCAPLIILVPLQITQFSLQLLHQRLHF 384
            |....|.:.|.:..|          |...:|.|..   :.:.|.|.:........|||....|..
  Fly   302 DALVNCNNMLRVLDH----------HKDFLGLLEERTVFASSLDIRLEESFESLQLQLARNPLKI 356

  Fly   385 SAAGFFNVDCTLLYTIVGATTTYLIILIQFHM 416
            :..|.|.:.......:..:.....|.||||.|
  Fly   357 NVMGMFPITRGSTAAMCASVIVNSIFLIQFDM 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr2aNP_001162633.1 7tm_7 7..418 CDD:285581 81/422 (19%)
Gr36bNP_724039.1 7tm_7 9..390 CDD:285581 81/422 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.