DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr2a and Gr77a

DIOPT Version :9

Sequence 1:NP_001162633.1 Gene:Gr2a / 31093 FlyBaseID:FBgn0265139 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_730560.1 Gene:Gr77a / 117476 FlyBaseID:FBgn0045474 Length:449 Species:Drosophila melanogaster


Alignment Length:487 Identity:101/487 - (20%)
Similarity:173/487 - (35%) Gaps:144/487 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PWRLAPPPDSEGI-LLRRSRWLELYGWTVLIAATSFT-VYGLFQESSVEEKQDSESTISSIGHTV 83
            |..||..|....| :....|||:|.|.:.|....|.| |:||...::.     |...|..:..::
  Fly     8 PLALAVSPQLGYIRITAMPRWLQLPGMSALGILYSLTRVFGLMATANW-----SPRGIKRVRQSL 67

  Fly    84 DFIQLVGMRVAHLAALLE--ALW---QRQAQRGFFAELGEIDRLLSKALRVDVEAMRINMRRQTS 143
             ::::.|..:........  |.|   ||.|   |..:    :|:|          :.|...|...
  Fly    68 -YLRIHGCVMLIFVGCFSPFAFWCIFQRMA---FLRQ----NRIL----------LMIGFNRYVL 114

  Fly   144 RR--AVWILWGYAVSQLLILGAKLLSRGDRFPIYWISYLLPLLVCGLRYFQIFNATQLVRQRLDV 206
            ..  |...||.:...|..|:|.  |:|              ||.|..|..::.: |:.::..:|.
  Fly   115 LLVCAFMTLWIHCFKQAEIIGC--LNR--------------LLKCRRRLRRLMH-TRKLKDSMDC 162

  Fly   207 L---------LVALQQLQLHQKGPAVDTVLEEQEDLEEAAMDRLIAVRLVYQRVWALVALLNRCY 262
            |         :|.|....|....|     ::..:|..|...:.:.|..||:  |....|:|....
  Fly   163 LATKGHLLEVVVLLSSYLLSMAQP-----IQILKDDPEVRRNFMYACSLVF--VSVCQAILQLSL 220

  Fly   263 G--------LSMLMQVGNDFLA-ITSNCYWMFLNFRQSAASPFDILQI-------VASGVWSAPH 311
            |        |..|::..|..|| |.::...:|.:.:::...| :..::       :|..:|...|
  Fly   221 GMYTMAILFLGHLVRHSNLLLAKILADAEHIFESSQKAGFWP-NRQELYKGQQKWLALELWRLLH 284

  Fly   312 LGNVLV-----LSLLCDRTAQC--------------------ASRLALCLHQVSVDLRNESHNAL 351
            :.:.|:     :..||...|.|                    .|:..|..:..|..|...:...|
  Fly   285 VHHQLLKLHRSICSLCAVQAVCFLGFVPLECTIHLFFTYFMKYSKFILRKYGRSFPLNYFAIAFL 349

  Fly   352 VGTLVRYCAPLIILVPLQITQ--------------------FSLQLLHQRLHF------------ 384
            ||.....   |::::|...::                    .:::.|...:||            
  Fly   350 VGLFTNL---LLVILPTYYSERRFNCTREIIKGGGLAFPSRITVKQLRHTMHFYGLYLKNVEHVF 411

  Fly   385 --SAAGFFNVDCTLLYTIVGATTTYLIILIQF 414
              ||.|.|.::..:|:.||||...||:|||||
  Fly   412 AVSACGLFKLNNAILFCIVGAILEYLMILIQF 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr2aNP_001162633.1 7tm_7 7..418 CDD:285581 101/487 (21%)
Gr77aNP_730560.1 7tm_7 37..444 CDD:285581 91/458 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.