DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr2a and Gr93c

DIOPT Version :9

Sequence 1:NP_001162633.1 Gene:Gr2a / 31093 FlyBaseID:FBgn0265139 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_732665.1 Gene:Gr93c / 117471 FlyBaseID:FBgn0045469 Length:397 Species:Drosophila melanogaster


Alignment Length:240 Identity:51/240 - (21%)
Similarity:90/240 - (37%) Gaps:59/240 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 QVCNLWPWRLAPPPDSEGILLRRSR-WLELYGWTVLIAATSFTVY----GLFQE----SSVEEKQ 70
            ::|.||..     |||..:...... :||:  .:::|....|..|    .|:.|    :.:|.::
  Fly   160 EICQLWHL-----PDSLSLFATLCEIFLEI--GSLMIIHIGFVGYLSVAALYSEVNSFARIELRR 217

  Fly    71 DSESTISSIGHTVDFIQL--VGMRVAHLAALLEALWQRQAQRGF--FAELGEIDRLLSKALRVDV 131
            ...|....:|..|...||  |..||....::.:.:  .:..|.|  ..||..:..||.|.....:
  Fly   218 QLRSLERPVGGPVGRKQLRIVEYRVDECISVYDEI--ERVGRTFHRLLELPVLIILLGKIFATTI 280

  Fly   132 EAMRINMRRQTSRRAVWILWGYAVSQ-----LLIL-------GAKLLSR--GDRFPI-------- 174
            .:..:.:|.:...|.:. :||..|..     ||.|       .::::.|  .:.|||        
  Fly   281 LSYEVIIRPELYARKIG-MWGLVVKSFADVILLTLAVHEAVSSSRMMRRLSLENFPITDHKAWHM 344

  Fly   175 YWISYLLPL-----LVCGLRYFQIFNATQLVRQRLDVLLVALQQL 214
            .|..:|..|     .|..|..|::.|         :|:|:.|..:
  Fly   345 KWEMFLSRLNFFEFRVRPLGLFEVSN---------EVILLFLSSM 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr2aNP_001162633.1 7tm_7 7..418 CDD:285581 51/240 (21%)
Gr93cNP_732665.1 7tm_7 18..393 CDD:285581 51/240 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.