DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr2a and Gr28a

DIOPT Version :9

Sequence 1:NP_001162633.1 Gene:Gr2a / 31093 FlyBaseID:FBgn0265139 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_523504.2 Gene:Gr28a / 117348 FlyBaseID:FBgn0041247 Length:450 Species:Drosophila melanogaster


Alignment Length:493 Identity:103/493 - (20%)
Similarity:193/493 - (39%) Gaps:132/493 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DTLRALEPLHRACQVCNLWPWRLAPPPDSEGILLRRSRWLELYG-----WTVLIAATSF----TV 57
            :..:||.|| ....:..|.|:||...|..|   ::.|::....|     :.||....|.    ::
  Fly    14 NVFQALRPL-TFISLLGLAPFRLNLNPRKE---VQTSKFSFFAGIVHFLFFVLCFGISVKEGDSI 74

  Fly    58 YGLFQESSVEEKQDSESTISSIGHTVDFIQLVGMRVAHLAALLEALWQRQAQRGFFAELG-EID- 120
            .|.|.::::....|....::.|   :....:.|..:.....|:..:.........|..|| ::| 
  Fly    75 IGYFFQTNITRFSDGTLRLTGI---LAMSTIFGFAMFKRQRLVSIIQNNIVVDEIFVRLGMKLDY 136

  Fly   121 -RLLSKALRVDVEAMRINMRRQTSRRAVWILWGYAVSQLLILGAKLLSRGDRFPIYWISYLLPLL 184
             |:|..:..:.:..:..|:        :::    .||..|::.|.:   ...| :.:.::.||.:
  Fly   137 RRILLSSFLISLGMLLFNV--------IYL----CVSYSLLVSATI---SPSF-VTFTTFALPHI 185

  Fly   185 VCGLRYFQIFNATQLVRQRLDVLLVALQQLQLHQKGPAVDTVLEEQEDLEEAAMDRLIAVRLVYQ 249
            ...|..|:....|.|.|.|..:|...||.:        :|..:|:...||.:.|..::..|....
  Fly   186 NISLMVFKFLCTTDLARSRFSMLNEILQDI--------LDAHIEQLSALELSPMHSVVNHRRYSH 242

  Fly   250 RVWALVAL------------LNRCYGLSMLMQVGN-----------------------DFLAITS 279
            |:..|::.            ||..|.:..:..:.|                       .||.|..
  Fly   243 RLRNLISTPMKRYSVTSVIRLNPEYAIKQVSNIHNLLCDICQTIEEYFTYPLLGIIAISFLFILF 307

  Fly   280 NCYWM---FLN------FRQSAASPFDILQIVASGVWSAPHLGNVLVLSLLCD---RTAQCASRL 332
            :.:::   .||      |.......|.::|:    :|      .::::.|:.:   ||...:|..
  Fly   308 DDFYILEAILNPKRLDVFEADEFFAFFLMQL----IW------YIVIIVLIVEGSSRTILHSSYT 362

  Fly   333 ALCLHQV-----SVDLRNESHNALVGTLVRYCAPLIILVPLQITQFSLQLLHQRLHFSAAGFFNV 392
            |..:|::     ..:||:                       ::.:.||||.|:::.|:|||.|.:
  Fly   363 AAIVHKILNITDDPELRD-----------------------RLFRLSLQLSHRKVLFTAAGLFRL 404

  Fly   393 DCTLLYTIVGATTTYLIILIQF----HMSESTIGSDSN 426
            |.||::||.||.|.||||||||    ||.:::..|.:|
  Fly   405 DRTLIFTITGAATCYLIILIQFRFTHHMDDTSSNSTNN 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr2aNP_001162633.1 7tm_7 7..418 CDD:285581 100/478 (21%)
Gr28aNP_523504.2 7tm_7 22..430 CDD:285581 96/471 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450300
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.