DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr2a and Gr39b

DIOPT Version :9

Sequence 1:NP_001162633.1 Gene:Gr2a / 31093 FlyBaseID:FBgn0265139 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_724336.1 Gene:Gr39b / 117347 FlyBaseID:FBgn0041245 Length:369 Species:Drosophila melanogaster


Alignment Length:419 Identity:90/419 - (21%)
Similarity:173/419 - (41%) Gaps:62/419 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LRALEPLHRACQVCNLWPWRLAPPPDSEGILLRRSRWLELYGWTVLIAATSFTVYGLFQESSVEE 68
            |.:..|..:...:..|.||       ||.  ..:|::::.....:||...: ..:|:    |:..
  Fly     2 LYSFHPYLKYFALLGLVPW-------SES--CAQSKFVQKVYSAILIILNA-VHFGI----SIYF 52

  Fly    69 KQDSESTISSIGHTVDFIQLVGMRVAHLAALLEALWQRQAQRGFFAELGEIDRLLSKALRVDVEA 133
            .|.:|..:|.:.:.:.|:..:   |.....:|:.:........|..|:..:...|...|::.|. 
  Fly    53 PQSAELFLSLMVNVIVFVARI---VCVTVIILQVMVHYDDYFRFCREMKYLGLRLQCELKIHVG- 113

  Fly   134 MRINMRRQTSRRAVWILWGYAVSQL----LILGAKLLSRGDRFPIYWISYLLPLLVCGLRYFQIF 194
               .::.|:..:.:.:..|:.|:.|    :.|...||        |:.|.||.:|:..:::..:.
  Fly   114 ---RLKWQSYAKILALGIGFLVTVLPSIYVALSGSLL--------YFWSSLLSILIIRMQFVLVL 167

  Fly   195 NATQLVRQRLDVLLVALQQ-LQLHQKGPAVDTVLEEQEDLEEAAMDRLIAVRLVYQRVWALVALL 258
            ...:|:...:.:|.:.||. |:.|..|  .:..|:...: ...:::.|:|::..:.::..|....
  Fly   168 LNVELLGHHVSLLGIRLQNVLECHLMG--ANCTLDGNAN-RLCSLEFLLALKQSHMQLHYLFTHF 229

  Fly   259 NRCYGLSMLMQVGNDFLAITSNCYWMFLNFRQSAASPFDILQIVASGVWSAPHLGNVLVLSLLCD 323
            |..:|.|:|......|...|.|.||.    :|.....::...:.|:.....|...|:||.     
  Fly   230 NDLFGWSILGTYVVLFSDSTVNIYWT----QQVLVEVYEYKYLYATFSVFVPSFFNILVF----- 285

  Fly   324 RTAQCASRLALCLHQ---VSVDLRNESHNALVGTLVRYCAPLIILVPLQITQFSLQLLHQRLHFS 385
              .:|..   .|..|   :...|||.|.:..:|....|...|:        :|.||:....|..:
  Fly   286 --CRCGE---FCQRQSVLIGSYLRNLSCHPSIGRETSYKDLLM--------EFILQVEQNVLAIN 337

  Fly   386 AAGFFNVDCTLLYTIVGATTTYLIILIQF 414
            |.||.:.|.:||.:|:.|..||||:|:||
  Fly   338 AEGFMSTDNSLLMSILAAKVTYLIVLMQF 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr2aNP_001162633.1 7tm_7 7..418 CDD:285581 89/416 (21%)
Gr39bNP_724336.1 7tm_7 5..367 CDD:303125 89/416 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.