DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32813 and MSANTD3

DIOPT Version :9

Sequence 1:NP_001368967.1 Gene:CG32813 / 31089 FlyBaseID:FBgn0052813 Length:699 Species:Drosophila melanogaster
Sequence 2:NP_001185734.1 Gene:MSANTD3 / 91283 HGNCID:23370 Length:275 Species:Homo sapiens


Alignment Length:205 Identity:47/205 - (22%)
Similarity:84/205 - (40%) Gaps:65/205 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YTQRERNMVLSYAAQYKDVIENKRTDAESNRKKDEVWLQIAKEFNSR-VYHQRSAKQLRQLYKNM 70
            :::.|::::|:...:||.|:|.|::||.:...|...|..:|.|:||: ....|..|||::.::|:
Human    13 FSELEKSILLALVEKYKYVLECKKSDARTIALKQRTWQALAHEYNSQPSVSLRDFKQLKKCWENI 77

  Fly    71 KLLLKKDLCGE--DKSNHSFMDLLNT-LSHQESVAQYIAEQL----SPEGAGGGGGGGKQGGAGN 128
            |...||.:..|  :|...|...||:| :..:|.:|..:.|||    ||                 
Human    78 KARTKKIMAHERREKVKRSVSPLLSTHVLGKEKIASMLPEQLYFLQSP----------------- 125

  Fly   129 GGGNGHQSDDYDDSKMPHYHEGMDTDVILIKSETISDNEQTDNGMDCLDEDDDDDCLSHKAPEVC 193
                        ..:.|.||    .|....:|..:|:.                        |:|
Human   126 ------------PEEEPEYH----PDASAQESFAVSNR------------------------ELC 150

  Fly   194 LEEEDDVLFP 203
            .:|::.:.||
Human   151 DDEKEFIHFP 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32813NP_001368967.1 Myb_DNA-bind_5 3..79 CDD:404714 23/72 (32%)
MSANTD3NP_001185734.1 Myb_DNA-bind_5 10..87 CDD:404714 23/73 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I12175
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012569
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.