Sequence 1: | NP_001368967.1 | Gene: | CG32813 / 31089 | FlyBaseID: | FBgn0052813 | Length: | 699 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001185734.1 | Gene: | MSANTD3 / 91283 | HGNCID: | 23370 | Length: | 275 | Species: | Homo sapiens |
Alignment Length: | 205 | Identity: | 47/205 - (22%) |
---|---|---|---|
Similarity: | 84/205 - (40%) | Gaps: | 65/205 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 YTQRERNMVLSYAAQYKDVIENKRTDAESNRKKDEVWLQIAKEFNSR-VYHQRSAKQLRQLYKNM 70
Fly 71 KLLLKKDLCGE--DKSNHSFMDLLNT-LSHQESVAQYIAEQL----SPEGAGGGGGGGKQGGAGN 128
Fly 129 GGGNGHQSDDYDDSKMPHYHEGMDTDVILIKSETISDNEQTDNGMDCLDEDDDDDCLSHKAPEVC 193
Fly 194 LEEEDDVLFP 203 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32813 | NP_001368967.1 | Myb_DNA-bind_5 | 3..79 | CDD:404714 | 23/72 (32%) |
MSANTD3 | NP_001185734.1 | Myb_DNA-bind_5 | 10..87 | CDD:404714 | 23/73 (32%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 46 | 1.000 | Domainoid score | I12175 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0012569 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.910 |