DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and AT1G73530

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_177494.1 Gene:AT1G73530 / 843687 AraportID:AT1G73530 Length:181 Species:Arabidopsis thaliana


Alignment Length:153 Identity:41/153 - (26%)
Similarity:65/153 - (42%) Gaps:23/153 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 CGPINTCKIMRDFKTGYSFGYGFVDYKTESDSEDAIQKLNGFYVRN-KRLKVSYARPGGQSIKDT 179
            ||.||.             |.|.:..:...|       :.|..:.: .....|.:.|...|...|
plant    33 CGRINV-------------GTGVISARRRRD-------IGGVLISSCLSTDSSSSPPSSSSGPKT 77

  Fly   180 NLYVINLSRNINDDMLDRIFSPYGLIVQRNILRDKLTGRPRGVAFVRYNKREEAQEAIKALNNTV 244
            .|||..||....:|.|...|..:|.::..|::.||:..||:|.||:||...|||.:||:.::...
plant    78 KLYVSGLSFRTTEDTLRDTFEQFGNLIHMNMVMDKVANRPKGFAFLRYETEEEAMKAIQGMHGKF 142

  Fly   245 PEGGSQPIWVRLAEEHGKAKAAQ 267
            .:|  :.|:|..|:.......|:
plant   143 LDG--RVIFVEEAKTRSDMSRAK 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 10/57 (18%)
RRM_SF 179..257 CDD:302621 28/77 (36%)
AT1G73530NP_177494.1 RRM 78..150 CDD:214636 26/73 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.