DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and PAB5

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001185373.1 Gene:PAB5 / 843507 AraportID:AT1G71770 Length:682 Species:Arabidopsis thaliana


Alignment Length:446 Identity:109/446 - (24%)
Similarity:172/446 - (38%) Gaps:102/446 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 NDNSAGQQQQMQQVDRT--------SATNLIINYLPQDMTDRELYNLFSGCGPINTCKIMRDFKT 130
            ||........:::.||.        |.||:.:..||:::||.||...|...|.|::..:|:| ::
plant   212 NDKQVFVGHFVRRQDRARSESGAVPSFTNVYVKNLPKEITDDELKKTFGKYGDISSAVVMKD-QS 275

  Fly   131 GYSFGYGFVDYKTESDSEDAIQKLNGFYVRNKRLKVSYARPGG------------------QSIK 177
            |.|..:|||::.:...:..|::|:||..:....|.|..|:...                  :.::
plant   276 GNSRSFGFVNFVSPEAAAVAVEKMNGISLGEDVLYVGRAQKKSDREEELRRKFEQERISRFEKLQ 340

  Fly   178 DTNLYVINLSRNINDDMLDRIFSPYGLIVQRNILRDKLTGRPRGVAFVRYNKREEAQEAIKALNN 242
            .:|||:.||..::||:.|..:||.||.:....::.:. .|..||..||.|:..|||..|:|.:|.
plant   341 GSNLYLKNLDDSVNDEKLKEMFSEYGNVTSCKVMMNS-QGLSRGFGFVAYSNPEEALLAMKEMNG 404

  Fly   243 TVPEGGSQPIWVRLAE--EHGKAKAAQFMAQIGGGNGGGGGGP--------PHMGPGGPMHPPHH 297
            .:.  |.:|::|.||:  |..:|.......||   ...|...|        .|..|||||..|||
plant   405 KMI--GRKPLYVALAQRKEERQAHLQSLFTQI---RSPGTMSPVPSPMSGFHHHPPGGPMSGPHH 464

  Fly   298 HNNHHHNNHHNPHMPPHHHQPQHPHQHPQHHPQLHHMQHHHPNNHNNNHPNNHHHNNNNNNHHNM 362
                       |....|:.|...|.|...:..|:..|....|                     ..
plant   465 -----------PMFIGHNGQGLVPSQPMGYGYQVQFMPGMRP---------------------GA 497

  Fly   363 GGPH---PHHMQQMHPMGMNMGM---GVNMGMGMGMGMPIHGGGGGGGGGGGGGGGGNFHHMAHR 421
            |.|:   |..:|:....|..:|.   ..||.........:........||.|....| ....|.:
plant   498 GPPNFMMPFPLQRQTQPGPRVGFRRGANNMQQQFQQQQMLQQNASRFMGGAGNRRNG-MEASAPQ 561

  Fly   422 GEVFMLPLPICSRFPSQPHPVGNGICHSPNKNSRFRLSRRPQASRTTIRYIAHSVA 477
            |   ::|||:            |...:|.|...|   |.:|  :..||..:|..:|
plant   562 G---IIPLPL------------NASANSHNAPQR---SHKP--TPLTISKLASDLA 597

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 25/79 (32%)
RRM_SF 179..257 CDD:302621 27/77 (35%)
PAB5NP_001185373.1 PABP-1234 59..661 CDD:130689 109/446 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.