DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and NUC-L1

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_175322.1 Gene:NUC-L1 / 841314 AraportID:AT1G48920 Length:557 Species:Arabidopsis thaliana


Alignment Length:349 Identity:68/349 - (19%)
Similarity:132/349 - (37%) Gaps:76/349 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SNADKMQDQEHDDEQ---------SSDIEGSGDNVGRDDGTDDDDDSNGNMQQENGDGGNGGDGQ 57
            |::|...|::.:||:         ::....|.|:  .|:.:|::.:.....|::.....:.....
plant   185 SSSDDDSDEDSEDEKPATKKAAPAAAKAASSSDS--SDEDSDEESEDEKPAQKKADTKASKKSSS 247

  Fly    58 EHSGDEEQHHSQDNEGNDNSAGQQQQMQQVDRTS-------------------ATNLIINYLPQD 103
            :.|.:.|:..|:|.|..........:|...:::|                   |.||..|....|
plant   248 DESSESEEDESEDEEETPKKKSSDVEMVDAEKSSAKQPKTPSTPAAGGSKTLFAANLSFNIERAD 312

  Fly   104 MTDRELYNLFSGCGPINTCKIMRDFKTGYSFGYGFVDYKTESDSEDAIQKLNGFYVRNKRLKVSY 168
            :.     |.|...|.:...:...:...|...|:|.|::.:..:::.|:: .:|..:..:.:::..
plant   313 VE-----NFFKEAGEVVDVRFSTNRDDGSFRGFGHVEFASSEEAQKALE-FHGRPLLGREIRLDI 371

  Fly   169 A-------------------RPGGQSIKDTNLYVINLSRNINDD----MLDRIFSPYGLIVQRNI 210
            |                   |.||....:..::|.....::::|    .|...||..|.|...::
plant   372 AQERGERGERPAFTPQSGNFRSGGDGGDEKKIFVKGFDASLSEDDIKNTLREHFSSCGEIKNVSV 436

  Fly   211 LRDKLTGRPRGVAFVRYNKREEAQEAIKALN-NTVPEGGSQPIWVRLAEEHGKAKAAQFMAQIGG 274
            ..|:.||..:|:|::.:::.:|     |||. |....||...:.|......|.:...   ...|.
plant   437 PIDRDTGNSKGIAYLEFSEGKE-----KALELNGSDMGGGFYLVVDEPRPRGDSSGG---GGFGR 493

  Fly   275 GNG----GGG----GGPPHMGPGG 290
            |||    |||    ||....|.||
plant   494 GNGRFGSGGGRGRDGGRGRFGSGG 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 15/98 (15%)
RRM_SF 179..257 CDD:302621 20/82 (24%)
NUC-L1NP_175322.1 RRM1_NUCLs 298..375 CDD:240896 15/82 (18%)
RRM2_NUCLs 402..479 CDD:240897 20/81 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.