DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and AT1G03457

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_973752.1 Gene:AT1G03457 / 839497 AraportID:AT1G03457 Length:438 Species:Arabidopsis thaliana


Alignment Length:313 Identity:78/313 - (24%)
Similarity:132/313 - (42%) Gaps:74/313 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 QQQMQQVDRTSATNLIINYLPQDMTDRELYNLFSGCGPINTCKIMRDFKTGYSFGYGFVDYKTES 145
            ::.|:..:|   ..|.:..:|:.||:.:|..||.....:|...|:::..|....|..|:...|. 
plant     3 EETMENEER---VKLFVGQVPKHMTEIQLLTLFREFSIVNEVNIIKEKTTRAPRGCCFLTCPTR- 63

  Fly   146 DSEDAIQKLNGFYVRNKR--------LKVSYARPGGQ----SIKDTN------LYVINLSRNIND 192
              |||.:.:|.|:  ||:        |:|.||  .|:    .:.|.:      |:|..|.:|:::
plant    64 --EDADKVINSFH--NKKTLPGASSPLQVKYA--DGELERLDVLDCSCNPEHKLFVGMLPKNVSE 122

  Fly   193 DMLDRIFSPYGLIVQRNILRDKLTGRPRGVAFVRYNKREEAQEAIKALNNT-VPEGGSQPIWVRL 256
            ..:..:||.||.|....|||..|. ..:|..|::|..:|:|..|::|||.. :.||.:.|:.|:.
plant   123 TEVQSLFSEYGTIKDLQILRGSLQ-TSKGCLFLKYESKEQAVAAMEALNGRHIMEGANVPLIVKW 186

  Fly   257 AEEHGKAKAAQFM------AQIGGGNGGGGGG------PPHMG-----PG--GPMHPPHHHNNHH 302
            |:...:.:|.:.:      :::...|....|.      ||:.|     ||  |.|.||....:..
plant   187 ADTEKERQARRLLKVQSHVSRLDPQNPSMFGALPMSYVPPYNGYGYHVPGTYGYMLPPIQTQHAF 251

  Fly   303 HN----NHHN--------------PHMPPHHHQP-------QHPHQHPQHHPQ 330
            ||    |..|              |.:.|..:.|       .|..|:|...|:
plant   252 HNVISPNQGNGRALQGTALTESVPPRLAPRRNFPTALGNYGYHGLQYPMAFPR 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 24/87 (28%)
RRM_SF 179..257 CDD:302621 26/84 (31%)
AT1G03457NP_973752.1 RRM1_2_CELF1-6_like 13..89 CDD:240807 21/80 (26%)
PABP-1234 <14..346 CDD:130689 76/299 (25%)
RRM1_2_CELF1-6_like 110..185 CDD:240807 25/75 (33%)
RRM3_CELF1-6 341..413 CDD:240808
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24012
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.