DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and AT1G01080

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001030925.1 Gene:AT1G01080 / 839463 AraportID:AT1G01080 Length:294 Species:Arabidopsis thaliana


Alignment Length:205 Identity:51/205 - (24%)
Similarity:91/205 - (44%) Gaps:20/205 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 DEEQHHSQDNEGNDNSAGQQQQMQQVDRTSATNLIINYLPQDMTDRELYNLFSGCGPINTCKIM- 125
            :|::......|...|......:.:.|.:.....|.:..:|:.....:|.::|...|.:.:.::: 
plant    77 EEKEEEVVKGEAEPNKDSVVSKAEPVKKPRPCELYVCNIPRSYDIAQLLDMFQPFGTVISVEVVS 141

  Fly   126 RDFKTGYSFGYGFVDYKTESDSEDAIQKLNGFYVRNKRLKVSYA---RPGGQSIKDT-------- 179
            |:.:||.|.|.|:|...:.:.::.||..|:|..|..:.::|.|:   .||.:...:.        
plant   142 RNPQTGESRGSGYVTMGSINSAKIAIASLDGTEVGGREMRVRYSVDMNPGTRRNPEVLNSTPKKI 206

  Fly   180 -------NLYVINLSRNINDDMLDRIFSPYGLIVQRNILRDKLTGRPRGVAFVRYNKREEAQEAI 237
                   .:||.||......|.|...||.:|.||...:|.|:.|||.|..||:.:...|| ::|.
plant   207 LMYESQHKVYVGNLPWFTQPDGLRNHFSKFGTIVSTRVLHDRKTGRNRVFAFLSFTSGEE-RDAA 270

  Fly   238 KALNNTVPEG 247
            .:.|.|..||
plant   271 LSFNGTQYEG 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 20/83 (24%)
RRM_SF 179..257 CDD:302621 26/84 (31%)
AT1G01080NP_001030925.1 RRM_SF 110..183 CDD:302621 17/72 (24%)
RRM 214..285 CDD:214636 26/68 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.