DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and PAB3

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_173690.1 Gene:PAB3 / 838882 AraportID:AT1G22760 Length:660 Species:Arabidopsis thaliana


Alignment Length:327 Identity:84/327 - (25%)
Similarity:140/327 - (42%) Gaps:62/327 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 TNLIINYLPQDMTDRELYNLFSGCGPINTCKIMRDFKTGYSFGYGFVDYKTESDSEDAIQKLNGF 157
            ||:.:..||:::.:.||...|...|.|::..:||| ::|.|..:|||:::....:..|::|:||.
plant   229 TNVYVKNLPKEIGEDELRKTFGKFGVISSAVVMRD-QSGNSRCFGFVNFECTEAAASAVEKMNGI 292

  Fly   158 YVRNKRLKVSYARPGGQSIKD------------------TNLYVINLSRNINDDMLDRIFSPYGL 204
            .:.:..|.|..|:...:..::                  .|||:.||..:::|:.|..:||.||.
plant   293 SLGDDVLYVGRAQKKSEREEELRRKFEQERINRFEKSQGANLYLKNLDDSVDDEKLKEMFSEYGN 357

  Fly   205 IVQRNILRDKLTGRPRGVAFVRYNKREEAQEAIKALNNTVPEGGSQPIWVRLAE--EHGKAKAAQ 267
            :....::.:. .|..||..||.|:..|||..|:..:|..:.  |.:|:::.||:  |..:|....
plant   358 VTSSKVMLNP-QGMSRGFGFVAYSNPEEALRALSEMNGKMI--GRKPLYIALAQRKEDRRAHLQA 419

  Fly   268 FMAQIGGGNGGGGGGPP---HMGPGGPM-HPPHHHNNHHHNNHHNPHMP-PHHHQPQ-------- 319
            ..:||      ...||.   |..||||| .||.|.....:.....|..| .:..|||        
plant   420 LFSQI------RAPGPMSGFHHPPGGPMPGPPQHMYVGQNGASMVPSQPIGYGFQPQFMPGMRPG 478

  Fly   320 ---------HPHQ-HPQHHPQL------HHMQHHHPNN---HNNNHPNNHHHNNNNNNHHNMGGP 365
                     :|.| .||..|::      .::|.|....   |.|..|...:.|..:|..:.|...
plant   479 SGPGNFIVPYPLQRQPQTGPRMGFRRGATNVQQHIQQQQLMHRNPSPGMRYMNGASNGRNGMDSS 543

  Fly   366 HP 367
            .|
plant   544 VP 545

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 24/79 (30%)
RRM_SF 179..257 CDD:302621 24/77 (31%)
PAB3NP_173690.1 PABP-1234 49..644 CDD:130689 84/327 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.