DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and AT5G51730

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_199986.2 Gene:AT5G51730 / 835247 AraportID:AT5G51730 Length:317 Species:Arabidopsis thaliana


Alignment Length:124 Identity:28/124 - (22%)
Similarity:39/124 - (31%) Gaps:50/124 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 EGNDNSAGQQQQMQQVDRTSATNLIINYLPQDMTDRELYNLFSGCGPINTCKIMRDFKTGYSFGY 136
            :|.|:|.|:                     .|:. |.|...||.||.|:......:........:
plant   196 KGYDSSLGE---------------------NDLA-RALLEHFSPCGMISRIYFQTNDAGEAVLKH 238

  Fly   137 GFVDYKTESDSEDAIQKLNG------------------FYVRNKRLKVSYARPGGQSIK 177
            .|:  .....:|||: ||||                  ||       |:|...||..||
plant   239 VFI--VMLQGTEDAL-KLNGSDMGGCNLEVHDATERDEFY-------VNYEVSGGPFIK 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 20/97 (21%)
RRM_SF 179..257 CDD:302621
AT5G51730NP_199986.2 RRM_SF 192..268 CDD:388407 20/96 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.