DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and RBP-DR1

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_567249.1 Gene:RBP-DR1 / 828090 AraportID:AT4G03110 Length:441 Species:Arabidopsis thaliana


Alignment Length:375 Identity:81/375 - (21%)
Similarity:147/375 - (39%) Gaps:84/375 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 QQQQMQQVDRTSATNLIINYLPQDMTDRELYNLFSGCGPINTCKIMRDFKTGYSFGYGFVDYKTE 144
            :::..::.:...:..|.:..:|:.|::.:|..||.....::...|::|..|..|.|..|:...:.
plant     5 KEENREKNEEEESVKLFVGQIPKHMSESQLLTLFQEFAVVDEVNIIKDKITRASRGCCFLLCPSR 69

  Fly   145 SDSEDAI------QKLNGFYVRNKRLKVSYARPGGQSIKDTNLYVINLSRNINDDMLDRIFSPYG 203
            .:::..:      :.|.|   .|..|:|.|| .|.....:..|:|..|.:|:::..:..:||.||
plant    70 EEADKLVNACHNKKTLPG---ANSLLQVKYA-DGELERLEHKLFVGMLPKNVSEAEVQSLFSKYG 130

  Fly   204 LIVQRNILRDKLTGRPRGVAFVRYNKREEAQEAIKALNNT-VPEGGSQPIWVRLA----EEHGK- 262
            .|....|||. .....:|.||::|..:|:|..|::::|.. ..||.:.|:.|:.|    |.|.: 
plant   131 TIKDLQILRG-AQQTSKGCAFLKYETKEQAVSAMESINGKHKMEGSTVPLVVKWADTERERHTRR 194

  Fly   263 -AKAAQFMAQIGGGNGGGGGGPPHMG--PGGPMHPPHHHNNHHHNNHHNPHMPPHHHQPQHPHQH 324
             .||...:|::|.|:   ...|...|  |.|.:.|.:.:..|.....:...:||..:|....:..
plant   195 LQKAQSHIARLGNGD---PTNPSLFGALPMGYVPPYNGYGYHQPPGTYGYMLPPIQNQAAFSNMI 256

  Fly   325 PQHHPQLHHMQHHHPNNHNNN---------------------HPNNHHHNNNNNNHHNMGGPHP- 367
            .|            ||..|||                     .|.|:           ||..:| 
plant   257 AQ------------PNQGNNNALQGTSPDSVPPRLARRNFPMPPGNY-----------MGSGYPA 298

  Fly   368 ---HHMQQMHPMG-------------MNMGMGVNMGMGMGMGMPIHGGGG 401
               |.....:|.|             ::.||...:|:|:...:...|..|
plant   299 MRGHPFPFAYPRGIVSPRPLSSSPGSISPGMSTPLGIGLSSVVQTEGPEG 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 19/85 (22%)
RRM_SF 179..257 CDD:302621 24/78 (31%)
RBP-DR1NP_567249.1 RRM1_2_CELF1-6_like 19..95 CDD:409796 16/78 (21%)
RRM1_2_CELF1-6_like 107..182 CDD:409796 23/75 (31%)
U2AF_lg <231..>423 CDD:273727 24/141 (17%)
RRM3_CELF1-6 351..423 CDD:409797
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24012
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.