DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and PHIP1

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_191094.1 Gene:PHIP1 / 824700 AraportID:AT3G55340 Length:597 Species:Arabidopsis thaliana


Alignment Length:290 Identity:58/290 - (20%)
Similarity:112/290 - (38%) Gaps:68/290 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSNADKMQDQE----HDDEQSSDIEGSGDNVGRDDGTDDDDDSNGNMQQENGDGGNGG--DGQEH 59
            :|..:|.::.|    .|||...:..|:|       |:.:..|:....:::..|.....  :|.|.
plant    47 LSKREKRRNCETFAREDDEIRENEVGNG-------GSSEKTDTKIKKKRKRDDAVEVDELEGDEG 104

  Fly    60 SGDEEQHHSQDN-----------------EGNDNSAGQQQQMQ------QVDRTSATNLIINYLP 101
            :.:|::...:.|                 |||.....:.::::      :.|......|.:..:|
plant   105 TKEEQKPQKKKNKKKKKKRKVNKTPKKAEEGNVEEKVKVEEIEVNTDNKEEDGVVPNKLYVGGIP 169

  Fly   102 QDMTDRELYNLFSGCGPI--NTCKIMRDFKTGYSFGYGFVDYKTESDSEDAIQKLNGF------- 157
            ...|:.|:.:.|..||.|  ..|| ||.....:| |..|:.:    |:||..::...|       
plant   170 YQSTEDEIRSYFRSCGVIIKVDCK-MRPEDGAFS-GIAFITF----DTEDGAKRALAFDRAAMGD 228

  Fly   158 -------YVRN------KRLKVSYARPGGQSIKDTN-LYVINLSRNINDDMLDRIFSPYGLIVQR 208
                   ||:.      :|...|...|  :.:...| :|:.||:.:..:..:.::||.. :|...
plant   229 RYLTIQQYVKTTTPSIPRRKTSSGFAP--EMVDGYNRVYIGNLAWDTTERDIRKLFSDC-VINSV 290

  Fly   209 NILRDKLTGRPRGVAFVRYNKREEAQEAIK 238
            .:.::|.||..:|.|.|.:........|:|
plant   291 RLGKNKETGEFKGYAHVDFKDSVSVAIALK 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 24/101 (24%)
RRM_SF 179..257 CDD:302621 15/61 (25%)
PHIP1NP_191094.1 RRM <129..327 CDD:223796 43/201 (21%)
RRM1_PHIP1 163..234 CDD:240717 19/76 (25%)
RRM2_PHIP1 263..334 CDD:240718 14/59 (24%)
PTZ00368 393..592 CDD:173561
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.