DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and AT2G47310

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_850472.1 Gene:AT2G47310 / 819344 AraportID:AT2G47310 Length:512 Species:Arabidopsis thaliana


Alignment Length:357 Identity:87/357 - (24%)
Similarity:136/357 - (38%) Gaps:76/357 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 QEHSGDEEQHHSQDNEGN-----------DNSAGQQQQMQQVDRT--SATNLIINYLPQDMTDRE 108
            |.|...::|:...|...|           .:|..:::.....|..  |...|.:..:.:..|:.:
plant    61 QPHYSGQQQNMIVDQSNNAPPPFPPSPCGGSSLRKRRSQSATDNADGSIAKLYVAPISKTATEYD 125

  Fly   109 LYNLFSGCGPINTCKIMRDFKTGYSFGYGFVDYKTESDSEDAIQKL-NGFYVRNKRL--KVSYAR 170
            :..:|...|.:....:.:|..||....|.|:.||...:...||..| ..|....:.|  ||.:|.
plant   126 IRQVFEKYGNVTEIILPKDKMTGERAAYCFIKYKKVEEGNAAIAALTEQFTFPGEMLPVKVRFAE 190

  Fly   171 PGGQSI--------KDTNLYVINLSRNINDDMLDRIFSPYGLIVQRNILRD--KLTGRPRGVAFV 225
            ...:.|        .:..|||..|::......::.:||.||:|....:..|  |:.   ||.|||
plant   191 AERERIGFAPVQLPDNPKLYVRCLNKQTTKMEVNEVFSRYGIIEDIYMALDDMKIC---RGYAFV 252

  Fly   226 RYNKREEAQEAIKALNN--TVPEGGSQPIWVRLAEEHGKAKAAQFMAQIGGGNGGGGGGPPHMGP 288
            :::.:|.|..||||||.  |: .|..||:.||.|:    .|..:...|....|     .||.|  
plant   253 QFSCKEMALAAIKALNGLFTI-RGSDQPLIVRFAD----PKKPRLGEQRSTFN-----TPPAM-- 305

  Fly   289 GGPMH-PPHHHNNHHHNNHHNPHMPP---HHH----QPQH-PHQHPQHHPQLHHMQHHH--PNNH 342
               .| .|:.|:..:....:....||   .||    ||.| |||:.|...::|...|..  |.|.
plant   306 ---QHFDPNWHSQPYPQWENKEPAPPRVVQHHDFSSQPNHFPHQNTQAVSEVHKPLHQDIPPANF 367

  Fly   343 N-------------------NNHPNNHHHNNN 355
            .                   ::|.|..|.:.|
plant   368 EKHQKSETASVETRSDGQKISSHSNAFHEDQN 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 19/82 (23%)
RRM_SF 179..257 CDD:302621 30/81 (37%)
AT2G47310NP_850472.1 RRM_SF 111..190 CDD:418427 18/78 (23%)
RRM_SF 208..287 CDD:418427 31/86 (36%)
WW 406..432 CDD:395320
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24012
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.970

Return to query results.
Submit another query.