DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and AT2G41060

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001078035.1 Gene:AT2G41060 / 818705 AraportID:AT2G41060 Length:451 Species:Arabidopsis thaliana


Alignment Length:511 Identity:111/511 - (21%)
Similarity:171/511 - (33%) Gaps:169/511 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DKMQDQ-EHDDEQSSDIEGSGDNVGRDDGTDDDDDSNGNMQQENGDG----------GNGGDGQE 58
            :|.|.| |.:|.:..::    ||...||....:.|:...|.:|...|          |:|..|.|
plant    19 EKQQQQCEKEDPEIRNV----DNQRDDDEQVVEQDTLKEMHEEEAKGEDNIEAETSSGSGNQGNE 79

  Fly    59 HSGDEE------QHHSQDN---------EGNDNSAGQQQQMQQVDRTSATNLIINYLPQDMTDRE 108
            ...:||      :..|:|.         |.:.:.|.:.:.:...|... ..:.::.|..|.....
plant    80 DDDEEEPIEDLLEPFSKDQLLILLKEAAERHRDVANRIRIVADEDLVH-RKIFVHGLGWDTKADS 143

  Fly   109 LYNLFSGCGPINTCKIMRDFKTGYSFGYGFVDYKTESDSEDAI---QKLNGFYVRNKRLK----- 165
            |.:.|...|.|..||.:.|..:|.|.||||:.:|:.|.:.:|:   ||..|..:...:|.     
plant   144 LIDAFKQYGEIEDCKCVVDKVSGQSKGYGFILFKSRSGARNALKQPQKKIGTRMTACQLASIGPV 208

  Fly   166 -----VSYARPGGQSIKDTNLYVINLSRNINDDMLDRIFSPYGLIVQRNILRDKLTGRPRGVAFV 225
                 |:.|:..........:||.|:|.:|:...|...||.:|.|.:..:..||.||||:|.|..
plant   209 QGNPVVAPAQHFNPENVQRKIYVSNVSADIDPQKLLEFFSRFGEIEEGPLGLDKATGRPKGFALF 273

  Fly   226 RYNKREEAQEAIKALNNTVPEGGSQPIWVRLAEEHGKAKAAQFMAQIGGGNGGGGGGPPHMGPGG 290
            .|...|.|::|::..:.|. ||                                           
plant   274 VYRSLESAKKALEEPHKTF-EG------------------------------------------- 294

  Fly   291 PMHPPHHHNNHHHNNHHNPHMPPHHHQPQHPHQHPQHHPQLHHMQHHHPNNHNNNHPNNHHHNNN 355
                   |..|.|..:..|.....|                   ||:|     |:|..|..:..|
plant   295 -------HVLHCHKANDGPKQVKQH-------------------QHNH-----NSHNQNSRYQRN 328

  Fly   356 NNNHHNMGGPHPHH-------MQQMHP----------MGMNMGMGVNMGMGMGM----------- 392
            :||.:...|.|.|.       :|..:|          .....|:|:|...|..:           
plant   329 DNNGYGAPGGHGHFIAGNNQAVQAFNPAIGQALTALLASQGAGLGLNQAFGQALLGTLGTASPGA 393

  Fly   393 --GMP------------IHGGGGGGGGGGGG--------GGGGNFHHMAHRGEVFM 426
              |||            ::.|.|...|..||        ||.|...|.|..|..:|
plant   394 VGGMPSGYGTQANISPGVYPGYGAQAGYQGGYQTQQPGQGGAGRGQHGAGYGGPYM 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 24/92 (26%)
RRM_SF 179..257 CDD:302621 25/77 (32%)
AT2G41060NP_001078035.1 RRM_SF 128..203 CDD:302621 21/74 (28%)
RRM_RBM24_RBM38_like 227..302 CDD:240830 28/125 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.