DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and AT2G37220

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_181259.1 Gene:AT2G37220 / 818299 AraportID:AT2G37220 Length:289 Species:Arabidopsis thaliana


Alignment Length:226 Identity:59/226 - (26%)
Similarity:103/226 - (45%) Gaps:35/226 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 DNEGNDNSAGQQQQMQQVDRTSATNLIINYLPQDMTDRELYNLFSGCGPINTCKIMRDFKTGYSF 134
            :.:|..:.|..::|....|    ..|.:..||.::...:|..||...|.:...:::.|..||.|.
plant    72 EEDGFADVAPPKEQSFSAD----LKLFVGNLPFNVDSAQLAQLFESAGNVEMVEVIYDKITGRSR 132

  Fly   135 GYGFVDYKTESDSEDAIQKLNGFYVRNKRLKVS--------------------------YARPGG 173
            |:|||...:.|:.|.|.|:.||:.:..:.|:|:                          |...||
plant   133 GFGFVTMSSVSEVEAAAQQFNGYELDGRPLRVNAGPPPPKREDGFSRGPRSSFGSSGSGYGGGGG 197

  Fly   174 QSIKDTN-LYVINLSRNINDDMLDRIFSPYGLIVQRNILRDKLTGRPRGVAFVRYNKREEAQEAI 237
            ......| :||.|||..::|..|:.:||..|.:|:..::.|:.:||.:|..||.|:..:|.|.||
plant   198 SGAGSGNRVYVGNLSWGVDDMALESLFSEQGKVVEARVIYDRDSGRSKGFGFVTYDSSQEVQNAI 262

  Fly   238 KALNNTVPEGGSQPIWVRLAEEHGKAKAAQF 268
            |:|:....:|..    :|::|...:....|:
plant   263 KSLDGADLDGRQ----IRVSEAEARPPRRQY 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 24/105 (23%)
RRM_SF 179..257 CDD:302621 27/78 (35%)
AT2G37220NP_181259.1 RRM_SF 92..170 CDD:418427 23/77 (30%)
RRM2_NsCP33_like 205..280 CDD:410187 26/78 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.