DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and AT2G35410

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_181084.1 Gene:AT2G35410 / 818107 AraportID:AT2G35410 Length:308 Species:Arabidopsis thaliana


Alignment Length:239 Identity:65/239 - (27%)
Similarity:103/239 - (43%) Gaps:38/239 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 QEHSGDEEQHHSQDNEGNDNSAGQQQQMQQVDRTSATNLIINYLPQDMTDRELYNLFSGCGPINT 121
            :|.|.|||....:..|...||..:::            |.:..||..|:..::..||..||.:|.
plant    71 KETSADEETSQEEKTEETQNSNLKRK------------LFVFNLPWSMSVNDISELFGQCGTVNN 123

  Fly   122 CKIMRDFKTGYSFGYGFVDYKTESDSEDAIQKLNGFYVRNKRLKVSYAR----PGGQSIKDT--- 179
            .:|:|. |.|.:.|:.||...:..:::.||.|.:.|.|..:.:.||:||    |..:|..|.   
plant   124 VEIIRQ-KDGKNRGFAFVTMASGEEAQAAIDKFDTFQVSGRIISVSFARRFKKPTPKSPNDLPSP 187

  Fly   180 -------NLYVINLSRNINDDMLDRIF--SPYGLIVQRNILRDKLTGRPRGVAFVRYNKREEAQE 235
                   .|||.||:.......|..:|  :.:..:..|.:..|. .||..|..||.:..||||:.
plant   188 APGDTRHKLYVSNLAWKARSTHLRELFTAADFNPVSARVVFADP-EGRSSGYGFVSFATREEAEN 251

  Fly   236 AIKALNNTVPEGGSQPIWVRLA------EEHGKAKAAQFMAQIG 273
            ||..||.....|  :||.::.:      .|.|.:..|...::.|
plant   252 AITKLNGKEIMG--RPITLKFSLRSASESEDGDSVEANNASEDG 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 26/83 (31%)
RRM_SF 179..257 CDD:302621 25/89 (28%)
AT2G35410NP_181084.1 PABP-1234 97..>279 CDD:130689 53/185 (29%)
RRM_SF 97..168 CDD:409669 21/71 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1072
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.