DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and rbm46

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001072501.1 Gene:rbm46 / 779956 XenbaseID:XB-GENE-1011216 Length:534 Species:Xenopus tropicalis


Alignment Length:274 Identity:54/274 - (19%)
Similarity:97/274 - (35%) Gaps:106/274 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 LIINYLPQDMTDRELYNLFSGCGPINTCKIMRDFKTGYSFGYGFVDYKTESDSEDAIQKLNGFYV 159
            :.:..:|:||.:.:|..||:..|.|...::|.:| :|.:.||.||.|..:.::..||:.||.:.:
 Frog    63 VFVGKIPRDMYEDKLVPLFARAGKIYEFRLMMEF-SGENRGYAFVMYTNKEEALLAIRMLNNYEI 126

  Fly   160 -----------------------RNKR-------------------------------------- 163
                                   :.||                                      
 Frog   127 CQGKFIGVCVSLDNCRLFIGSIPQEKRKEEILEEMKKVTEGVMDVIVYPSATDKTKNRGFAFVMY 191

  Fly   164 ------------------------LKVSYARPGGQSIKDTN-----LYVINLSRNINDDMLDRIF 199
                                    :||::|.|..:..::|.     |||.||..:..::.:...|
 Frog   192 ESHRAAAMARRKLIPGPFQLWGHTIKVAWASPEKEVDEETMQKVKVLYVRNLMMSTTEETIKAEF 256

  Fly   200 SPY--GLIVQRNILRDKLTGRPRGVAFVRYNKREEAQEAIKALNNTVPEGGSQPIWVRLAEEHGK 262
            :.|  |::.:...:||        .|||.:.:|:.|..|:..:|..:.:|..  |.|.||:...|
 Frog   257 NRYKPGVVERVKKIRD--------YAFVHFFRRDYAIAAMSVMNGRLIDGAR--IEVTLAKPVNK 311

  Fly   263 AKAAQFMAQIGGGN 276
            ..|   ..|.|.|:
 Frog   312 EAA---WRQNGNGH 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 26/162 (16%)
RRM_SF 179..257 CDD:302621 21/84 (25%)
rbm46NP_001072501.1 hnRNP-R-Q 20..495 CDD:273732 54/274 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.