DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and hnrnpa3

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001315077.1 Gene:hnrnpa3 / 751729 ZFINID:ZDB-GENE-060224-1 Length:340 Species:Danio rerio


Alignment Length:393 Identity:89/393 - (22%)
Similarity:134/393 - (34%) Gaps:139/393 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 EGNDNSAGQQQQMQQVDRTSATNLIINYLPQDMTDRELYNLFSGCGPINTCKIMRDFKTGYSFGY 136
            |..|:...:|.:          .|.|..|..:.|:..|...|...|.:..|.:|||.....|.|:
Zfish     2 ESRDSKEPEQLR----------KLFIGGLSFETTEDSLRAHFEQWGKLTDCVVMRDPANKRSRGF 56

  Fly   137 GFVDYKTESDSEDAI----QKLNGFYVRNKRL--KVSYARPGGQ-SIKDTNLYVINLSRNINDDM 194
            |||.|.:.|:.:.|:    .|::|..|..||.  :....:||.. ::|  .::|..:..:..:..
Zfish    57 GFVTYSSVSEVDAAMTARPHKVDGRVVEPKRAVSREDSNKPGAHLTVK--KIFVGGIKEDTEEYH 119

  Fly   195 LDRIFSPYGLIVQRNILRDKLTGRPRGVAFVRYNKREEAQEAIKALNNTVPEGGSQPIWVR--LA 257
            :...|..||.|...:|:.::.||:.||..||.::..:...:.:....:|:   .|....||  |.
Zfish   120 IREYFECYGKIETIDIMEERSTGKKRGFCFVTFDDHDTVDKIVAQKYHTI---NSHNCEVRKALP 181

  Fly   258 EEHGKAKAAQFMAQIGGGN--------------GGGGGGPPHMGPGGPMHPPHHHNNHHHNNHHN 308
            ::..::.:.|.....||||              ||.|||..:.|.||                  
Zfish   182 KQEMQSSSNQRYRGGGGGNFTGRGGNFGRGGYGGGRGGGDGYNGFGG------------------ 228

  Fly   309 PHMPPHHHQPQHPHQHPQHHPQLHHMQHHHPNNHNNNHPNNHHHNNNNNNHHNMGGPHPHHMQQM 373
                                                                |.||         
Zfish   229 ----------------------------------------------------NYGG--------- 232

  Fly   374 HPMGMNMGMGVNMGMGMGMGMPIHGGGGG-----------------GGGGG--GGGGGGNFHHMA 419
            .|.|...|.|   |.|.|.|....|||||                 |||||  |||||||::...
Zfish   233 GPGGYGGGRG---GYGGGPGYGNQGGGGGFGGFDNYNDRGNFGGNFGGGGGSSGGGGGGNYNDFG 294

  Fly   420 HRG 422
            :.|
Zfish   295 NYG 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 25/85 (29%)
RRM_SF 179..257 CDD:302621 16/79 (20%)
hnrnpa3NP_001315077.1 RRM1_hnRNPA_like 14..91 CDD:241022 24/76 (32%)
RRM2_hnRNPA3 104..183 CDD:241026 18/83 (22%)
HnRNPA1 <296..>315 CDD:288479 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.