DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and hnrnpab

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_012814656.1 Gene:hnrnpab / 734098 XenbaseID:XB-GENE-6042555 Length:326 Species:Xenopus tropicalis


Alignment Length:429 Identity:83/429 - (19%)
Similarity:133/429 - (31%) Gaps:146/429 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSNADKMQDQEHDDE---QSSDIEGSGDNV-GRDDGTDDDDDSNGNMQQENGDGGNGGDGQEHSG 61
            ||:.::.|..|...|   ::.|.|.:...| |..:|.:             ||..|...|:|.:|
 Frog     1 MSDTEQQQYMETGTENGHEACDAEAAESKVPGGQNGAE-------------GDQINASKGEEDAG 52

  Fly    62 DEEQHHSQDNEGNDNSAGQQQQMQQVDRTSATNLIINYLPQDMTDRELYNLFSGCGPINTCKIMR 126
            ......|...||                   ..:.:..|..|.:.::|.:.||..|.::.|.|..
 Frog    53 CVPDISSPLTEG-------------------VKMFVGGLSWDTSKKDLKDYFSKFGEVSDCTIKM 98

  Fly   127 DFKTGYSFGYGFVDYKTESDSEDAIQ----KLNGFYVRNKRLKVSYARPGGQSIKDTNLYVINLS 187
            |..||.|.|:||:.:|..:..:..::    :|:|..:..|:.......|    ||  .::|..|:
 Frog    99 DPNTGRSRGFGFILFKDAASVDKVLEQKEHRLDGRLIDPKKAMAMKKDP----IK--KIFVGGLN 157

  Fly   188 RNINDDMLDRIFSPYGLIVQRNILRDKLTGRPRGVAFVRYNKREEAQEAI-KALNNTVPEGGSQP 251
            ....:|.:...|..:|.|....:..|..|.:.||..|:.:.:.|..::.: |..:|.  .|....
 Frog   158 PEAGEDKIREYFETFGEIEAIELPMDPKTNKRRGFVFITFKEEEPVKKILEKKFHNV--SGSKCE 220

  Fly   252 IWVRLAEEHGKAKAAQFMAQIGGGNGGGGGGPPHMGPGGPMHPPHHHNNHHHNNHHNPHMPPHHH 316
            |.:        |:..:...|..||.||..||  ..|.||                          
 Frog   221 IKI--------AQPKEVYQQQYGGRGGSFGG--RGGRGG-------------------------- 249

  Fly   317 QPQHPHQHPQHHPQLHHMQHHHPNNHNNNHPNNHHHNNNNNNHHNMGGPHPHHMQQMHPMGMNMG 381
                                                                     ...|.|..
 Frog   250 ---------------------------------------------------------KAQGQNWN 257

  Fly   382 MGVNMGMGMGMGMPIHGGGGGGGGGGGGGGGGNFHHMAH 420
            .|.|.....|.|    ..|.||.|..|.||.||:.:..:
 Frog   258 QGYNSYWNQGYG----NQGYGGYGQQGYGGYGNYDYSGY 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 20/83 (24%)
RRM_SF 179..257 CDD:302621 16/78 (21%)
hnrnpabXP_012814656.1 CBFNT 1..52 CDD:311868 15/63 (24%)
RRM1_hnRNPAB 66..140 CDD:241201 19/73 (26%)
RRM2_hnRNPAB 145..224 CDD:241028 19/94 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.