DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and LOC681410

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_003751688.1 Gene:LOC681410 / 681410 RGDID:1595414 Length:307 Species:Rattus norvegicus


Alignment Length:358 Identity:84/358 - (23%)
Similarity:132/358 - (36%) Gaps:80/358 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 VDRTSATNLIINYLPQDMTDRELYNLFSGCGPINTCKIMRDFKTGYSFGYGFVDYKTESDSEDAI 151
            ::.:....|.|..|....::..|...|...|.:..|.::.:.:|..|..:|||.|....:::.|:
  Rat     1 MENSQLCKLFIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAM 65

  Fly   152 ----QKLNGFYVRNKRL--KVSYARPGGQSIKDTNLYVINLSRNINDDMLDRIFSPYGLIVQRNI 210
                ..::|..|..||.  :...||||..: |...|:|..|..::.:..|...||.:|.:.:..|
  Rat    66 AASPHAVDGNTVELKRAVSREDSARPGAHA-KVKKLFVGGLKGDVAEGDLIEHFSQFGAVEKAEI 129

  Fly   211 LRDKLTGRPRGVAFVRYNKREEAQEA--IK---------ALNNTVPE-----GGSQPIWVRLAEE 259
            :.||.:|:.||..||.:...:.|.:|  :|         .:...||:     ||......|....
  Rat   130 IADKQSGKKRGFGFVYFQSHDAADKAAVVKFHPIQGHRVEVKKAVPKEDIHAGGGGARAARGGRG 194

  Fly   260 HGKAKAAQFMAQIGGGNGGGGG----GPPHMGPGGPMHPPHHHNNHHHNNHHNPHMPPHHHQPQH 320
            .|:.:        |||.|||||    |....|.||       :|::.....:..           
  Rat   195 GGRGR--------GGGGGGGGGRDQNGLAKGGGGG-------YNSYGGYGGYGA----------- 233

  Fly   321 PHQHPQHHPQLHHMQHHHPNNHNNNHPNNHHHNNNNNNHHNMGGPHPHHMQQMHPMGMNMGMGVN 385
                                 :........:..::..|.....|.:..|.....||....|.|  
  Rat   234 ---------------------YGGGGGGGSYGGSDYGNGFGGFGSYSQHQSSYGPMKSGGGGG-- 275

  Fly   386 MGMGMGMGMPIHGG---GGGGGGGGGGGGGGNF 415
             |.|...|...:.|   ||.|||||||.|||:|
  Rat   276 -GGGGSWGGRSNSGPYRGGYGGGGGGGYGGGSF 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 21/85 (25%)
RRM_SF 179..257 CDD:302621 23/93 (25%)
LOC681410XP_003751688.1 RRM1_hnRNPA0 5..83 CDD:240772 18/77 (23%)
RRM2_hnRNPA0 99..178 CDD:241023 20/78 (26%)
HnRNPA1 250..>269 CDD:288479 4/18 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.