DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and cirbpb

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001035411.2 Gene:cirbpb / 678563 ZFINID:ZDB-GENE-030131-5841 Length:206 Species:Danio rerio


Alignment Length:256 Identity:58/256 - (22%)
Similarity:93/256 - (36%) Gaps:90/256 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 LYVINLSRNINDDMLDRIFSPYGLIVQRNILRDKLTGRPRGVAFVRYNKREEAQEAIKALNNTVP 245
            |::..||.:..:..|:..||.||.|.:.:::||:.|.|.||..||.:...|:|::|:.|:|....
Zfish     7 LFIGGLSYDTTEQSLEEAFSKYGTIAKVDVIRDRETDRSRGFGFVTFENPEDAKDAMAAMNGKQV 71

  Fly   246 EGGSQPIWVRLAEEHGKA--KAAQFMAQIGGGNGGGGG---GPPHMGPGGPMHPPHHHNNHHHNN 305
            :|.    .:|: :|.||:  ::..|.   ||..|||.|   |....|.||               
Zfish    72 DGR----MIRV-DEAGKSGGRSGGFR---GGSRGGGRGFFRGSRGRGGGG--------------- 113

  Fly   306 HHNPHMPPHHHQPQHPHQHPQHHPQLHHMQHHHPNNHNNNHPNNHHHNNNNNNHHNMGGPHPHHM 370
                                                        :..:.:..:..:.||...:..
Zfish   114 --------------------------------------------YGGDRSYGSDRSFGGDRSYGG 134

  Fly   371 QQMHPMGMNMGMGVNMGMGMGMGMPIHGGG----GGGGGG-----GGGGGGGNFHHMAHRG 422
            .:.:..|         ..|.|.|...:|||    ||||||     ||...||.:....::|
Zfish   135 DRSYGGG---------DRGYGGGERSYGGGDRSYGGGGGGYSNRSGGYSSGGGYRDNRNQG 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621
RRM_SF 179..257 CDD:302621 24/75 (32%)
cirbpbNP_001035411.2 RRM <2..>81 CDD:223796 24/78 (31%)
RRM_SF 5..83 CDD:302621 25/80 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.